KEGG   Rhodopseudomonas palustris BisB18: RPC_2269Help
Entry
RPC_2269          CDS       T00336                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00970  Aminoacyl-tRNA biosynthesis
rpc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RPC_2269
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rpc03029]
    RPC_2269
Enzymes [BR:rpc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RPC_2269
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RPC_2269
Mitochondrial biogenesis [BR:rpc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RPC_2269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ABD87823
UniProt: Q215W3
LinkDB All DBs
Position
2469464..2470948
Genome map
AA seq 494 aa AA seqDB search
MNAPVKPSKLIKGATGDWEIVIGLEVHAQVSSKSKLFSGASTEFGGDPNAHVSLVDAAMP
GMLPVINEECVKQAVRSGLGLNAQINLRSTFDRKNYFYPDLPQGYQISQFKSPIVGEGEV
QVDVADGDGVTVGIERLHLEQDAGKLLHDQNPTMSLVDLNRSGVALMEIVSKPDIRSADQ
AKAYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRKPGAPLGTRCEIKNVNSIRFIGQA
IDYEARRQIGILEDGGSIDQETRLFDAGKGETRSMRSKEEAHDYRYFPDPDLLPLQFDQA
FVDALKAELPELPDAKKARFIADFGLSADDAGVLVSERESAEFYETVLSKLADAGRDGKL
AANWVINELFGRLNKEGVAIEASPVSTAQLAAIVDLIGEATISGKIAKELFEIVWQEGGD
PRATVEARGMRQVTDTGAIEKVVDDIVNANPDKVAQAQAKPALIGWFVGQVMKSSGGKAN
PQTVNDLLKSKLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacctgtcaaaccatcgaagctgatcaagggcgccaccggcgattgggagatc
gtgatcgggctggaggttcatgcccaggtcagctcgaagtcgaagctgttttccggcgcc
tcgaccgaattcggcggcgaccccaacgcccacgtctcgctggtcgacgcggcgatgccg
gggatgctgccggtgatcaacgaggaatgcgtcaagcaggcggtgcgcagcgggctcggc
ctcaacgcccagatcaacctgcgctcgaccttcgaccgcaagaactatttctatcccgac
ctgccgcagggctaccagatcagccagttcaaatctccgatcgtcggcgagggcgaagtg
caagtcgacgtcgcggacggcgacggcgtcactgtcggcatcgagcggctgcatctggaa
caggacgccggcaagctgctgcacgaccagaacccgacgatgtcgctggtcgatctcaac
cgctccggcgtggcgctgatggagatcgtctccaagccggacatccgctctgcggaccag
gccaaggcttacgtcaccaagctgcgcaccatcctgcgttatctcggcacctgcgacggc
gacatggagaagggcagtctgcgcgccgacgtcaacgtctcggtgcgcaagcccggtgcg
ccgctcggcacccgctgcgagatcaagaacgtcaattcgatccgtttcatcggccaggcg
atcgactatgaagcgcgccgccagatcggcattctggaagacggcggctcgatcgatcag
gagacccggctgttcgacgccggcaagggcgagacccgctcgatgcggtcgaaggaagag
gcgcacgactatcgctacttccccgatcccgacctgttgccgctgcagttcgaccaggcc
ttcgtcgacgcgctgaaagcggaactgccggaactgccggacgccaagaaggcgcgcttc
atcgccgatttcggcttgtcggcggacgacgctggcgtgctggtcagcgagcgcgagagc
gcggagttctacgagacggtgctgtcgaagctcgccgatgcaggccgcgatggcaagctc
gccgccaattgggtgatcaacgaattgttcggccggctcaacaaggagggcgtggcgatc
gaagcctcaccggtgtccaccgcgcaactggcggcgatcgtcgacctgatcggcgaggca
accatctccggcaagatcgccaaggaactgttcgagatcgtctggcaggagggcggtgat
ccgcgggcgaccgtcgaagcgcgcggcatgaggcaggtcaccgacacgggcgcgatcgag
aaggtggtcgacgacatcgtcaacgccaaccccgacaaggtcgcgcaggcgcaggccaag
ccggcactgatcggctggttcgtcgggcaggtgatgaaatcgtcgggcggcaaggccaat
ccgcagaccgtcaacgacctgttgaagagcaagctcggcctctga

DBGET integrated database retrieval system