KEGG   Rhodopseudomonas palustris BisB18: RPC_2869Help
Entry
RPC_2869          CDS       T00336                                 

Definition
(GenBank) biotin carboxylase / acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00061  Fatty acid biosynthesis
rpc00620  Pyruvate metabolism
rpc00640  Propanoate metabolism
rpc01100  Metabolic pathways
rpc01110  Biosynthesis of secondary metabolites
rpc01120  Microbial metabolism in diverse environments
rpc01130  Biosynthesis of antibiotics
rpc01200  Carbon metabolism
rpc01212  Fatty acid metabolism
Module
rpc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:rpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPC_2869
   00640 Propanoate metabolism
    RPC_2869
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RPC_2869
Enzymes [BR:rpc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     RPC_2869
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     RPC_2869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ABD88417
UniProt: Q213L9
LinkDB All DBs
Position
3121354..3122709
Genome map
AA seq 451 aa AA seqDB search
MFDKILIANRGEIALRVLRACKELGIATVAVHSTADADAMHVRLADESVCIGPPPSKDSY
LNIPALLAACEITGADAVHPGYGFLSENARFAEILAEHNLHFIGPKSEHIRLMGDKIEAK
KTARRLGIPVVPGSEGAVGPEDDAMAIAKAIGFPVLVKAASGGGGRGMKVAQTEADLMLA
LSTAGNEAKSAFGDASVYLEKYLQKPRHIEIQVLGDGRGGAIHLGERDCSLQRRHQKVWE
EGPSPVLSAEARAKIGATCAKAMQDMQYLGVGTIEFLYEDGEFYFIEMNTRIQVEHPVTE
MITGIDLVLEQIRVAAGGDLPCTQDEIVLNGHAIECRVNAENPVTFRPSPGRIVRYHPPG
GLGVRIDSAAYQDYVIPPYYDSMVGKLIVHGKTRAECLMRLRRALDEMVVDGIETTLPLF
RALVREPGIIDGDYHIHWLEHYLAAGDTKKP
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacaaaatcctgatagccaatcgcggcgagatcgcgctgcgcgtgttgcgggcc
tgcaaggagctcggcatcgccaccgtcgcggtgcactccaccgccgatgccgacgccatg
catgtccggctcgccgacgagagcgtctgcatcgggccgccgccgtccaaggacagctac
ctcaacatcccggcgctgctcgccgcctgcgagatcaccggcgccgacgcggtgcatccc
ggctacggctttctgtcggagaacgcccgcttcgccgagatcctggccgagcacaatctg
catttcatcggcccgaaatccgaacacatccgactgatgggcgacaagatcgaggccaag
aagaccgcgcgccggctcggcattccggtggtgccgggctccgagggcgcggtcggcccc
gaggacgacgccatggcgatcgccaaggcgatcgggtttccggtgctggtcaaggccgcc
tcgggcggcggcggccgcggcatgaaggtggcgcagaccgaagccgacctgatgctggcg
ctgtcgaccgccggcaacgaggccaagtcggcgttcggcgacgcctcggtctatctggaa
aaatatctgcagaagccgcgccacatcgagatccaggtgctcggcgacggccgcggcggc
gccattcatctcggcgagcgcgactgctcgctgcagcgccgccaccagaaggtctgggag
gaaggcccctcgccggtgctcagcgccgaggcccgcgccaagatcggcgcgacctgcgcc
aaggcgatgcaggacatgcagtatctcggcgtcggcaccatcgaattcctctacgaagac
ggcgagttctacttcatcgagatgaacacccgaatccaggtcgagcatccggtcaccgag
atgatcaccggcatcgacctcgtgctggagcaaatccgggtcgccgccggcggcgacttg
ccctgcacccaggacgagatcgtgctcaacggccacgccatcgaatgccgggtcaatgcc
gagaacccggtgaccttccggccctcgccgggccggatcgtgcgctaccacccgccgggc
gggctcggggtgcggatcgattccgccgcctaccaggactatgtgattccgccctattac
gattcgatggtcggcaagctgatcgtgcacggcaagacccgggcggaatgcctgatgcgg
ctgcgccgcgcgctcgacgaaatggtggtcgacggcatcgaaactacgctgccgttgttc
cgcgcgctggtgcgggagcccggcatcatcgacggcgattaccatatccattggctggag
cattatctggcggcgggcgacaccaaaaagccctga

DBGET integrated database retrieval system