KEGG   Rhodopseudomonas palustris BisB18: RPC_3871Help
Entry
RPC_3871          CDS       T00336                                 

Definition
(GenBank) Phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00440  Phosphonate and phosphinate metabolism
rpc01100  Metabolic pathways
rpc01120  Microbial metabolism in diverse environments
rpc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rpc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    RPC_3871
Enzymes [BR:rpc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     RPC_3871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-ProteinID: ABD89400
UniProt: Q20ZN6
LinkDB All DBs
Position
4302803..4303762
Genome map
AA seq 319 aa AA seqDB search
MADWKAKYSASESLRELLHNGSLSFAMEAHNGLSAIIAEKAGFEVIWASGLAISASLGLR
DSNEATWCQVLTIAEFMADAVEIPIILDGDSGHGNFNTVRRLVRKACDRRIAGVCLEDKL
FPKMNSFIQSGQILANVDEFAGRIMAAKDTQTSAAFTVIARTEALIAGRSLAEALDRAST
YASAGADAIVIHSAKSTADEVLAFADAWANRCPLIIIPTKYYTTPTQLFRQARISLAIWA
NHSLRASVASMQAVCSRIVREQSVKGVEPSISKLETIFDLLKYDELLAAEQRYFPANGAL
TPGIPRVPKNIVSATKPAE
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcggattggaaggcaaagtattcagcaagcgaaagtttgcgcgaactactccataac
ggctcgctatcatttgccatggaggcgcacaacggattgtcggcaataatagcggagaag
gccggctttgaagtgatttgggcctcggggctggcgatttcggcatcgttaggtctgcgc
gattcaaacgaagccacgtggtgtcaggttctaaccatcgcggagttcatggcagatgcc
gtggaaatcccgattattctcgatggagattccggccacggaaatttcaacacggtgcgg
cgccttgtccggaaagcctgcgatcgtcgtatcgcgggagtttgcttggaagacaaactt
ttccctaaaatgaactctttcatccaaagcggacaaattttggcgaacgtcgacgagttt
gccgggcgcataatggcagcgaaggacacacagactagcgccgcgtttaccgtcatcgcc
cgaactgaggcactcattgctggacgatcccttgctgaggcactggatcgtgccagtact
tatgcttcggcgggcgccgatgcgatcgtaattcattcggcgaagtcaactgccgacgaa
gttctggctttcgcagatgcatgggcaaatcgatgcccgctgatcatcattcctacaaaa
tactatacgacacccacgcagctttttcgacaagcgcgtatctctctggcaatctgggca
aatcactcgctgcgagcttccgtggcgtcgatgcaggccgtttgcagccgcatcgtgcgg
gagcagtcggtcaagggcgtcgaacctagtatttccaagctggagacgattttcgatctt
ctcaaatatgatgagcttttggccgctgaacagcggtattttccggcgaatggagctttg
accccgggcatccctcgggtgccaaaaaatatcgtctcggcgacgaagccggcagaatga

DBGET integrated database retrieval system