KEGG   Rhodopseudomonas palustris BisB5: RPD_0294Help
Entry
RPD_0294          CDS       T00345                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rpd01100  Metabolic pathways
rpd01110  Biosynthesis of secondary metabolites
rpd01130  Biosynthesis of antibiotics
rpd01230  Biosynthesis of amino acids
Module
rpd_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:rpd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPD_0294
Enzymes [BR:rpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     RPD_0294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 Cytidylate_kin2 AAA_18 Mg_chelatase AAA_17 CoaE TsaE Cytidylate_kin AAA_22 RsgA_GTPase AAA_16
Motif
Other DBs
NCBI-ProteinID: ABE37532
UniProt: Q13EF7
LinkDB All DBs
Position
complement(338433..339047)
Genome map
AA seq 204 aa AA seqDB search
MSEIAPPADAARSQEAEIVAALGERAVVLIGMMGAGKSTVGRRLALRLGLPFLDADTEIE
SAAAMTIPEIFDTHGEPHFRDGEARVIARLLDGGAKVLATGGGAFMREETRDRIRDKAVS
LWLEADADVILRRVKRRADRPLLKTPDPAGTIARLIDERYPVYRSADLTIASRDVPHEKI
VDECVAALHGYLCCAAAPTLSETP
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaatcgcaccgccggccgacgccgcccggtcccaggaagccgagatcgtcgcg
gcgctgggcgagcgcgcggtcgtgctgatcggcatgatgggcgccggcaagtcgaccgtc
ggccgccgtctggcgctgcggctcgggctgccgtttctcgacgccgacaccgagatcgag
tccgccgcggcgatgaccatcccggagattttcgacactcacggcgagccgcatttccgc
gacggcgaggcgcgggtgatcgcgcggctgctcgacggcggcgccaaggttctggcgacc
ggcggcggcgccttcatgcgcgaggaaacccgcgaccggatccgcgacaaagcggtgtcg
ctgtggctcgaagccgacgccgacgtgatcctgcggcgggtgaagcgtcgcgccgatcgg
ccgctgctcaagacgccggatcccgccgggaccatcgcccggctgatcgatgagcgctat
ccggtgtatcgcagcgccgacctcaccatcgcgtcgcgcgacgtgccgcacgagaagatc
gtcgatgaatgcgttgcggcgttgcacggctatctgtgctgcgccgctgcgccaaccctg
agcgagaccccatga

DBGET integrated database retrieval system