KEGG   Rhodopseudomonas palustris BisB5: RPD_0808Help
Entry
RPD_0808          CDS       T00345                                 

Definition
(GenBank) glutathione S-transferase-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RPD_0808
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpd02000]
    RPD_0808
Enzymes [BR:rpd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RPD_0808
Transporters [BR:rpd02000]
 Other Transporters
  Pores ion channels [TC:1]
   RPD_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_N_2 GST_N GST_N_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ABE38046
UniProt: Q13CZ3
LinkDB All DBs
Position
complement(912636..913250)
Genome map
AA seq 204 aa AA seqDB search
MKLYYSPGACSLSPHIALSESGLPFELVKVDIRAKKLENGDDYTQINPKGSVPALGLDDG
GVLTEGPAIVQMIADKVGGGKLAPENGTAERYRLQEWLNFISTDLHKSFGPLFSPVLGDE
AKTFFKDRIAKYFAYADKQLAGKDYLMGSQFTVADGYLFVILTWADRMKIDMSTFANLAA
FKARVAARPKVQDALRSEGLLQKT
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttattattcacccggagcgtgttcgctctcgccgcatattgcgctcagcgaa
tccggcctgccgtttgaactggtcaaggtcgacatccgggcgaagaagctggaaaacggc
gacgactacacccagatcaatcccaagggatcggtcccggcgctcggtctcgacgacggc
ggcgtgctgaccgaaggcccggcgatcgtgcagatgatcgccgacaaggtcggcggcggt
aaactcgcacccgagaacggcacggccgagcgctatcggctgcaggaatggctgaatttc
atttccaccgacctgcacaagagcttcggcccgctgttctccccggtgctcggcgacgaa
gccaagactttcttcaaggaccgcatcgcaaaatattttgcctatgccgacaaacagctc
gccggaaaggattacctgatgggctcgcagttcacggtggcggacggctatctgttcgtg
atcctgacctgggccgaccggatgaagatcgacatgtcgaccttcgccaatctcgccgcc
ttcaaggcccgcgtcgccgcacggccgaaggtgcaggatgcgctgcggagcgaagggttg
ctgcagaagacgtaa

DBGET integrated database retrieval system