KEGG   Rhodopseudomonas palustris BisB5: RPD_1545
Entry
RPD_1545          CDS       T00345                                 

Definition
(GenBank) cyclohex-1-ene 1-carbonyl-CoA hydratase
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00362  Benzoate degradation
rpd01100  Metabolic pathways
rpd01120  Microbial metabolism in diverse environments
rpd01220  Degradation of aromatic compounds
Module
rpd_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:rpd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPD_1545
Enzymes [BR:rpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     RPD_1545
SSDB
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Other DBs
NCBI-ProteinID: ABE38782
UniProt: Q13AV7
LinkDB
Position
1722244..1723020
AA seq 258 aa
MPENVIIVEREGRVGIVTLNRPEVLNALNDELMDALGAALLAFDADDGIGAIVIAGTARA
FAAGADIAGMAEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDII
VAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRV
VDDDRLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADA
REGIRAFLEKRKPSFVHR
NT seq 777 nt   +upstreamnt  +downstreamnt
gtgccagagaacgtgatcatcgtcgaaagggaagggcgggtcgggatcgtcacgctcaat
cggcctgaagtcctcaacgcgctcaacgatgagctgatggatgcgctcggcgccgcgttg
ctcgccttcgacgccgacgacggcatcggcgccatcgtgattgccggtacggcgcgggcg
tttgcggcaggcgccgacatcgcgggcatggcggaatggagctacagcgacgtttacagt
tcgaacttcatcacgcggaattgggagaccatcaaacgggtccgcaagccggtgctggcg
tcggtcgcgggtctcgcattcggcggcggatgcgaattggcgttggcgtgcgacatcatc
gtcgccgcgcgcagcgcgaagtttgcgcttccggagatcaagctcggcctgctgccgggg
gcaggcggcacgcagcgcctaccgcgcgccattggcaaggccaaggcgatggacatgtgc
ctgtccgcacgcccgctcgacgctgaagaggccgatcgctatggcctggtctcacgtgtg
gtcgacgacgacaggctccgcgaggaaacaatgaagctcgccacgacgatcgcttctttc
tcagctccggcattgatggcgctgaaggaaagcctcaatcgcgcttttgaaattccgctt
gcggagggaatcctgttcgaacggcgcgaactgcacgcccgtttcgcgaccgccgatgcc
cgcgagggcattcgggcctttctggaaaagcgaaagccgagcttcgtccatcgctga

DBGET integrated database retrieval system