KEGG   Rhodopseudomonas palustris BisB5: RPD_1548Help
Entry
RPD_1548          CDS       T00345                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00630  Glyoxylate and dicarboxylate metabolism
rpd00710  Carbon fixation in photosynthetic organisms
rpd01100  Metabolic pathways
rpd01120  Microbial metabolism in diverse environments
rpd01200  Carbon metabolism
Module
rpd_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rpd_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rpd_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RPD_1548
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RPD_1548
Enzymes [BR:rpd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RPD_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small IclR
Motif
Other DBs
NCBI-ProteinID: ABE38785
UniProt: Q13AV4
LinkDB All DBs
Position
complement(1726429..1726791)
Genome map
AA seq 120 aa AA seqDB search
MTTPIKDYQSRISDPNSRKLGTFSYLPPMDAEQLRKQINYIVNQGWTAAIEHTEPSHATG
YYWYMWKLPMFGETDVDRVLTEIEACRAANPNHHVRLIGYDNVVQTQGTSMLVYRAPIEV
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgaccactccgataaaggactatcagtcccgtatctccgatccgaacagccgcaagctc
ggcaccttctcctatctgccgccgatggatgccgagcagctgcgcaagcagatcaactac
atcgtcaaccagggctggacggcggcgatcgagcacaccgagccgagccatgccaccggt
tactactggtacatgtggaagctgccgatgttcggtgagaccgacgtcgaccgtgtcctc
accgaaatcgaggcctgccgcgccgccaatccgaaccaccacgttcggctgatcggctac
gacaacgtcgtccagacccaaggcaccagcatgctggtgtatcgcgcaccgatcgaggtc
tga

DBGET integrated database retrieval system