KEGG   Rhodopseudomonas palustris BisB5: RPD_3204Help
Entry
RPD_3204          CDS       T00345                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
rpd  Rhodopseudomonas palustris BisB5
Brite
Translation factors [BR:rpd03012]
 Eukaryotic Type
  Elongation factors
   RPD_3204
 Prokaryotic Type
   RPD_3204
Mitochondrial biogenesis [BR:rpd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RPD_3204
Exosome [BR:rpd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RPD_3204
  Exosomal proteins of breast cancer cells
   RPD_3204
  Exosomal proteins of colorectal cancer cells
   RPD_3204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase Lsm_C
Motif
Other DBs
NCBI-ProteinID: ABE40429
UniProt: Q134R0
LinkDB All DBs
Position
complement(3554206..3555396)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETSNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKCDMVDDPELLELVEMEVRELLSKYDFPGDDIPIVKGSALAALE
NSDAKLGHDAILELMKAVDAYIPQPERPIDQPFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIRDTQKTTCTGVEMFRKLLDQGQAGDNIGCLLRGTKREDVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNIA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcaaagtttgaacgaaacaagccgcattgcaacatcgggacgatcggtcac
gtcgaccatggcaagacgtcgctgacggcggcgatcaccaaggttctggcggagactggc
ggcgcgacgttcacggcgtatgaccagatcgacaaggcgccggaagagaaggcgcgtggc
atcacgatctcgacggctcacgtcgagtacgagacgtccaatcgccactacgcgcatgtc
gactgccccggccacgccgactacgtgaagaacatgattaccggcgcggcgcagatggac
ggcgcgatcctggtggtttcggcggctgacggcccgatgccgcagacccgcgagcacatc
cttctggcgcgccaggtcggcgttccggcgctggtggtgttcctgaacaagtgcgacatg
gtcgacgatccggaactgctcgagctggtcgagatggaagtccgcgagttgctgtcgaag
tacgacttcccgggcgacgacattccgatcgtcaagggctcggcgctcgccgcgctcgag
aactcggatgcgaagctcggccatgacgcgatcctggagctgatgaaggcggtcgacgcc
tacattccgcagccggagcgtccgatcgaccagccgttcctgatgccggttgaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggtcgcgtcgagcgcggcatcgtcaag
gtcggcgaggaaatcgagatcgttggcatccgcgacacgcagaagaccacctgcaccggc
gtcgaaatgttccgcaagctgctcgatcagggccaggccggcgacaacatcggctgcctg
ctgcgcggcaccaagcgtgaggacgtcgagcgcggccaggtgctgtgcaagccgggttcg
gtgaagccgcacaccaagttcaaggccgaggcctacatcctgaccaaggaagagggcggt
cgtcacactccgttcttcaccaactaccgtccgcagttctacttccgcaccaccgacgtg
accggtgtggttcatctgccggaaggcaccgagatggtgatgccgggcgacaacatcgcg
atggaagtgcacctgatcgtgccgatcgcgatggaagagaagctgcgcttcgccatccgc
gaaggcggccgcaccgtcggcgccggcgtcgtcgcttcgatcatcgagtaa

DBGET integrated database retrieval system