KEGG   Rhodopseudomonas palustris BisB5: RPD_3483Help
Entry
RPD_3483          CDS       T00345                                 

Definition
(GenBank) Trehalose synthase-like
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00500  Starch and sucrose metabolism
rpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RPD_3483
Enzymes [BR:rpd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RPD_3483
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     RPD_3483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459
Motif
Other DBs
NCBI-ProteinID: ABE40706
UniProt: Q133N3
LinkDB All DBs
Position
3867244..3870546
Genome map
AA seq 1100 aa AA seqDB search
MNLMSTIDATNSKPELEATDELWYKDAIIYQLHVKAFADSNNDGIGDFAGLTEKLDYLQD
LGVTALWLLPFYPSPQRDDGYDIGDYGSINPDFGTMKDFRRFIVEAKKRNLRVITELVIN
HTSDQHDWFKRARRSEKGSSARNWYVWSDTDQKYQGTRIIFTDTEKSNWTWDPEAGQYYW
HRFFSHQPDLNFDNPHVVSALVKVMKRWLDTGVDGFRLDAIPYLCERDGTNNENLPETHA
VIKQLRAELDAYAKGKVLLAEANQWPEDVQEYFGHSDECHMAYHFPLMPRIYMAIAQEDR
FPITDIMRQTPEIPANCQWAMFLRNHDELTLEMVTDVERDYLWKTYAADPRARINVGIRR
RLAPLMDNDRRKIELMNSLLLSFPGTPIIYYGDEIGMGDNIYLGDRNGVRTPMQWSSDRN
GGFSRADPARLYAPTIMDPVYGYASVNVEAQARSLSSLLSATKRLISVRKSTFAFGRGTM
TFIRPANRSVLAYVRQYEDEVILCVANLSRSAQATELDLSPWKDRVPQEMLGRTRFPAIG
ELPYMITLAPYGFYWFKLEERDTSQHVAPAAAVPEFETLVVPVGATWMSLARTRGVFERD
VLPAHLSRTRWFPERSPRSIHPRVTSAIPFSNTHENRPWLAFFEATVRGVDARYVLPMQI
DWVRFDRERYNPHAFAAVRQGAREGTLLDVATDVEFVTLLLDNLRESVVVENEGVRLQFR
PGSRLAEKPAVAYHDIRAVETEQSNSTALVGEHYVIKLYRRLQSGINPEIEMGRFLTEVA
GYTNTPSLLGSVELVEGDKVSAIAVVHDFVANQGDGWIVTSGYLDRYVDDQRLLINSEEQ
HVSEELAPYRHYMQQTGKRVAEMHIALSSHPEQPDFAPAPISSDDAERWTGIVTENAKRV
LDELQHKRESLKDAERAIVDELLAQRDGIFERLRGLFGSDGGLNIRHHGDFHLGQMLIVK
DDVFIIDFEGEPRRSQAERRAKAPAARDVAGLVRSIDYSTTAALERALKVSTDETGKIAA
ALDGWRIRSTEAFLTAYRETMGDSLVWPADRAAADRLLDFFLIEKALYEIEYELAHRPDW
LRVPLAGILRILTRQPEEIS
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgatgtcaacgatcgacgcgaccaattccaagcccgagctcgaggcgaccgac
gagctgtggtacaaagacgcgatcatctaccagctccacgtcaaggcgttcgccgacagc
aacaatgacggcatcggcgatttcgccggcctgacggagaagctggactatctgcaggac
ctcggcgtcaccgcgctgtggctgctgccgttctatccctcgccgcagcgcgacgacggc
tacgacatcggcgattacggctcgatcaatcccgacttcggcacgatgaaggatttccgc
cgcttcatcgtcgaggcgaagaagcgcaatctgcgcgtcatcaccgagctggtcatcaac
cacacgtccgaccagcacgactggttcaagcgcgcccggcgcagcgaaaagggctcgagc
gcacgcaactggtatgtctggagcgacaccgaccagaaatatcagggcacccggatcatc
ttcaccgacaccgagaagtcgaactggacctgggatcccgaggccggccaatattattgg
caccgcttcttttcgcatcagcccgacctgaatttcgacaatccgcatgtcgtcagcgcc
ctcgtcaaggtgatgaagcgctggctcgacaccggcgtcgacggcttccggctcgacgca
attccctatctgtgcgagcgcgacggcaccaacaacgagaaccttcccgagacccacgcc
gtcatcaagcagttgcgcgccgagctcgatgcttacgccaagggcaaggtgctgctggcg
gaggccaatcaatggccggaggacgtccaggaatatttcggccatagcgacgaatgtcac
atggcctatcacttcccgctgatgccgcggatctacatggcgatcgcccaggaagatcgc
tttccgatcaccgacatcatgcggcagacaccggaaatccccgccaactgtcaatgggcg
atgttcctgcgcaatcacgacgagctgacgctggaaatggtcaccgacgtcgagcgcgat
tatctgtggaagacctatgcggccgatccgcgcgctcgcatcaatgtcggcatccgccgc
cgcctcgcgccgctgatggacaatgaccgccgcaagatcgagctgatgaactcgctgctg
ctgtcgttccccggcacgccgatcatctattacggcgacgaaatcggcatgggcgacaac
atctatctcggcgaccgcaacggcgtccgcacgccgatgcaatggtcgtcggatcgcaat
ggcggcttctcacgcgccgacccggcgcgactctatgccccgaccatcatggacccggtc
tacggctacgcgtcggtcaatgtcgaggcgcaggcgcgcagcctctcgtcgctgctcagc
gcgaccaagcggctgatttcggtccgcaaatccaccttcgccttcggccgcggcacgatg
acgttcatccggcccgcgaaccgctcggtgctcgcttatgtccggcagtacgaagacgag
gtgatcctctgcgtcgccaatctgtcgcgttcggcgcaggccaccgaactcgatctgtcg
ccgtggaaggaccgcgtgccgcaggaaatgctcggacgcacgcgttttccggcgatcggc
gaactgccttacatgatcacgctggcgccctacggcttctactggttcaagctggaggag
cgcgacacatcccagcacgtcgcgcccgcagccgccgtgcccgagttcgaaaccctggtg
gtgcctgtcggcgcaacatggatgtcgctcgcccgcacccgcggcgtgttcgagcgcgat
gtgctgccggcgcatctgtcgcgcacccggtggtttccagagcgttcgccgcgttcgatc
catccgcgagtcacctcggccattccattctcgaacacccatgagaaccgcccgtggctg
gcgttcttcgaggcgaccgtgcgcggcgtcgatgcccgctatgtgctgccgatgcagatc
gactgggtgcggttcgatcgcgagcgctacaatccgcacgccttcgccgccgtgcgtcag
ggcgcacgcgagggcacgctgctcgatgtcgccaccgacgtcgaattcgtcaccctgctc
ctcgacaatctgcgcgagtcggtcgtggtggagaatgagggcgtccgactgcaattccgc
cccggctcgcgtctggccgagaagcccgccgtcgcgtatcacgatatccgcgcggtcgag
accgagcagtcgaattccacggcgctggtcggcgaacactacgtcatcaagctgtatcgc
cggctgcaaagcggcatcaatccggaaatcgaaatgggccgcttcctcaccgaggtcgcg
ggctataccaacaccccgtctctgctcggcagcgtcgaactggtcgagggcgacaaggtc
agcgcgatcgcggtggtgcatgatttcgtcgccaaccagggcgacggctggatcgtgaca
tcgggttatctcgaccgctatgtcgacgaccagcggctgctgatcaattccgaagaacag
cacgtcagcgaggagctggcgccgtaccggcactacatgcagcagaccggcaaacgcgtc
gccgaaatgcacatcgcgctgtcaagccatccggagcagcccgactttgctcccgcgccg
atcagcagcgacgacgccgagcgctggaccggtatcgtcaccgagaacgccaagcgggtg
ctcgacgagttgcagcacaagcgcgagagcctgaaagacgccgaacgggccatagtggac
gagctgctggcgcaacgcgacgggattttcgagcggctgcgcggactgttcggcagcgac
ggcggcctgaacatccgccatcatggcgacttccatctcggccagatgctgatcgtcaag
gacgacgtcttcatcatcgatttcgaaggcgagccgcggcggtcgcaggccgagcgccgc
gccaaggcacccgccgcgcgcgacgtcgcggggctggtgcgctcgatcgactattccacc
accgcagcgctggagcgcgcgctgaaagtctcgaccgacgaaaccggcaagatcgccgcg
gcactcgatggctggcggattcggtcgaccgaagcgttcctcaccgcctaccgcgaaacg
atgggcgacagcctggtctggcccgccgatcgcgccgcagccgatcggttactggacttt
ttcctgatcgagaaggcattgtatgagatcgaatacgaactcgcccaccgtcccgactgg
ctccgcgtgccgctggctggcatccttcgtatcctgacccggcagcccgaggagatttca
tga

DBGET integrated database retrieval system