KEGG   Rhodopseudomonas palustris BisB5: RPD_3490Help
Entry
RPD_3490          CDS       T00345                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rpd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    RPD_3490
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rpd03400]
    RPD_3490
Enzymes [BR:rpd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RPD_3490
DNA repair and recombination proteins [BR:rpd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     RPD_3490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ABE40713
UniProt: Q133M6
LinkDB All DBs
Position
complement(3880200..3882992)
Genome map
AA seq 930 aa AA seqDB search
MVAGKTLTLYRNKRDFEQTAEPRGDGKVAPSKRRRFVIQKHDATRLHYDLRLEYNGVFKS
WAVTRGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVQLWDRGYWECDDPERG
FKKGDLKFSLDGEKLQGSWVLVRMRHDRNGGKRTNWLLIKHRDDDAREGKANDILDQDRS
VASGRAMTEIAQGKGRAPKPFMTGKAARVKADAVWNSKEGLAADERAANGAGGAVASKPA
PPNKAKATTAKSKTAKSKTAKVAKPKPGRKAAAKRAAMPDFVPPQLCTSVERPPGGDGWG
HEIKFDGYRMQLRVDAGEATLKTRKGLDWTARFQAIADQAAGLPDALIDTEIVALDQHGH
PDFAALQAALSDGDTDNLICFAFDLLHADGEDLRALPLSDRKRRLQELLTAARGRRKQGL
IRYVEHFDTGGDAILQSACKLSLEGIVSKKLDAPYRSGRSDNWTKAKCRAGHEVVIGGWK
TNAGKFRSLLVGVHHDDHLAYVGIVGTGFGQDVVKRLLPELKAHAAKDNPFAGENAPRKT
ADVHWLAPELVAEIEFAGFTGAGMVRQAAFKGLRADKPAGEVEAEEPAKVDIAGPKPGRR
AKPSSNAKSAKPKTATPNAGRSKTRATHASRAEVMGVVISKPDKELWPASRIGDAVNKRD
LAHYYEAVGDWMIPHLEGRPCSIVRAPDGIGGEHFFQRHAMPGMSNLIALAKVAGDRKPY
VQIDRVEGLIAAAQIGGLELHPWNCAPGRYEVPGRLVFDLDPAPEVGFDAVIVAAREMKD
RLEAIGLPSFCKTTGGKGLHVVTPLVPSDDIDWKQAKIFAQTVCAGMADDSPDRYLLNMS
KQQRKGKIFLDYLRNDRMSTAVAVLSPRAREGATVSMPLTWTQVKAGLDPKRYTVETVPA
LLAKTKAWADYDKAAAPLKAAIKKLAFSRA
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atggtggcaggcaagactctcacgctgtatcgcaacaagcgcgacttcgagcagaccgcc
gagccgcgcggcgatggcaaggtcgcgccgtcgaagcggcggcgtttcgtgatccagaag
cacgacgccacgcggctgcactacgacctgcggctggaatataacggcgtgttcaagtcc
tgggcggtgacgcgcgggccgtcgctcgatccgcacgacaagcggctcgcggtcgaggtc
gaggaccatccgctcgactacggcgacttcgaaggcacgattcccaagggccaatatggc
ggcggcaccgtgcagctctgggatcgcggctattgggagtgcgacgatccggagcgcggt
ttcaagaagggcgacctcaaattctcgctggacggcgagaagttgcagggaagctgggtg
ctggtgcggatgcgccatgatcgcaacggcggcaagcgaaccaactggttgctgatcaag
catcgcgacgacgacgcccgcgagggaaaggccaacgatattctcgaccaggaccgctcg
gtggcgtccggccgcgcgatgacagagatcgcacaggggaaaggccgcgcgccaaaaccg
ttcatgaccggcaaggcggcgcgcgtgaaggccgacgcggtatggaattcgaaggagggg
ctggccgcagacgagcgtgcggccaatggcgcgggcggggcggtcgcgtcgaagccggcg
ccgccgaacaaggcgaaggcgaccaccgcaaagtccaagacggcaaagtccaagacggcc
aaggtcgcgaagccgaagccggggcgcaaggctgcggcgaagcgcgcggcgatgccggat
ttcgttccgccgcagctctgcacctcggtcgagcggccgcccggcggcgatggctggggt
cacgagatcaaattcgacggctaccggatgcagctacgcgtcgacgccggcgaggcgacg
ctgaagacccgcaagggattggactggaccgccagatttcaggcgatcgccgaccaggcg
gcgggcctgcccgatgcgctgatcgacaccgagatcgtcgcgctcgatcagcacggccac
ccggatttcgcggcgctgcaggcggcgttgtcggacggcgacacggacaatctgatctgc
tttgcgttcgacctgctccatgccgatggcgaggatctgcgtgcgttgccgctgtccgac
cgcaagcggcggctgcaggagttgctcacggccgcgcgcggccggcgcaagcagggcctg
atccgctatgtcgagcatttcgacaccggcggcgacgcgatcctgcaatccgcctgcaag
ctgtcgctcgaaggcatcgtctcgaagaagctcgatgcgccctatcgatccggccgcagc
gacaactggaccaaggcgaagtgccgggccgggcacgaggtggtgatcggcggctggaag
accaatgcgggcaaatttcgttcgctgctggtcggcgtgcatcacgacgatcatcttgct
tatgtcggcatcgtcggcaccggcttcgggcaggatgtggtgaagcgactgctgccggaa
ttgaaagcccacgccgccaaggacaatccatttgccggcgagaacgcgccgcgcaagacc
gccgatgtgcattggctggcgccggagcttgtggccgagatcgagttcgccggcttcacc
ggcgccggcatggtgcggcaggccgcattcaaggggctgcgcgcggacaagccggccggg
gaggtcgaagcggaggagcctgcgaaggtcgatatcgccgggccgaagcccggacgccgc
gccaagccctcatccaacgccaagtcggccaagccaaagaccgcaacgccgaacgcggga
cgcagcaagacccgcgcgacccatgccagtcgcgccgaggtgatgggcgtggtgatctcc
aagccggacaaggagctgtggcccgcgagccggatcggcgatgcggtcaacaagcgcgat
ctcgcgcactactacgaagcggtcggcgattggatgatcccgcatctcgaggggcggccg
tgttcgatcgtccgcgcgcccgacgggatcggcggcgaacacttcttccagcgacacgca
atgccggggatgtcgaacctgatcgcgcttgcgaaagtggcgggcgaccgcaagccttac
gtgcagatcgaccgggtcgaaggattgatcgctgcggcgcagatcggcggccttgaactg
catccgtggaattgtgcgccgggtcggtacgaggtccccgggcggctggtgttcgatctc
gatccggcgcccgaagtcgggttcgacgcggtgatcgtggcggcgcgtgaaatgaaggac
cggctcgaggcgatcggcctgccgagcttctgcaagaccaccggcggcaaggggctgcac
gtggtgacgccgctggtccccagcgacgatatcgactggaagcaggccaaaatcttcgcg
cagacggtgtgcgccgggatggccgacgacagccccgatcgctatctgctcaacatgtcg
aagcagcagaggaagggaaagatcttcctggactatctgcgcaacgaccggatgtcgacc
gcggtcgctgtgctgtcgcctcgcgcacgcgagggcgcgacggtgtcgatgccgttgacg
tggacgcaggtgaaagccgggctcgatcccaagcgatacacggtcgagacagttccagcg
ctgctggcaaagaccaaagcctgggcggactacgacaaagccgcggccccgctgaaagcg
gcgatcaagaagctcgcgttcagcagggcttga

DBGET integrated database retrieval system