KEGG   Rhodopseudomonas palustris BisA53: RPE_0022Help
Entry
RPE_0022          CDS       T00400                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rpe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RPE_0022
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpe02000]
    RPE_0022
Enzymes [BR:rpe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RPE_0022
Transporters [BR:rpe02000]
 Other Transporters
  Pores ion channels [TC:1]
   RPE_0022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 HrpE
Motif
Other DBs
NCBI-ProteinID: ABJ03983
UniProt: Q07VQ1
LinkDB All DBs
Position
23525..24232
Genome map
AA seq 235 aa AA seqDB search
MMPKPLIRHRDWIMLTVHHLNNSRSQRVLWLLEELEVPYQIERYQRGPDMMAPKELRAVH
PLGKSPVITDNGNTIAESGAIIEYIIATYGNGRLIPPQNTPERLRYTYWLHYAEGSAMTP
LLLKLLFTLMPKRAPALIRPLVRAFTSAVVTGFVDPQLKQHMDFWESELAKSEWFAGNDF
SAADIQMSFPLEAASARGGLAQGHPKATAFLARIHARPAYARALQKGGPYEIGKA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgaagccactcattcgacatagggactggatcatgctcacggtgcaccatctc
aacaattcgcgctcgcagcgggtgctgtggctcttggaagagctggaggtgccgtatcag
atcgagcgctaccagcgcggcccggacatgatggcgccgaaggaactccgcgccgtgcat
ccgctcggcaagtcgccggtgatcaccgacaacggcaacactatcgccgaatccggcgcg
atcatcgagtacatcatcgccacctacggcaacggccggctgatcccgccgcaaaacacg
ccggagcggctgcgctacacctattggctgcactacgccgaaggctcggcgatgacgccg
ttgctgctgaagctgctgttcacgctgatgcccaagcgcgcgccggcgctgatccgcccg
ctggtgcgggccttcacctcggcggtggtgaccggcttcgtcgatccgcagctgaagcag
cacatggatttttgggagagcgaactggcgaaatccgaatggttcgccggcaatgatttc
agcgccgccgatatccagatgagttttccgctcgaagccgcctccgcccgcggcgggctg
gcgcagggccatcccaaggcgaccgcgttcctcgcccgcatccacgcccggccagcctat
gcccgtgcgctgcaaaagggtgggccgtacgagatcgggaaggcgtag

DBGET integrated database retrieval system