KEGG   Rhodopseudomonas palustris BisA53: RPE_0143Help
Entry
RPE_0143          CDS       T00400                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rpe01100  Metabolic pathways
rpe01110  Biosynthesis of secondary metabolites
rpe01130  Biosynthesis of antibiotics
rpe01230  Biosynthesis of amino acids
Module
rpe_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:rpe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPE_0143
Enzymes [BR:rpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     RPE_0143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 Cytidylate_kin2 AAA_18 Mg_chelatase CoaE ETF AAA_17 dNK TsaE Cytidylate_kin AAA_22 RsgA_GTPase AAA_16 AAA_5
Motif
Other DBs
NCBI-ProteinID: ABJ04104
UniProt: Q07VD0
LinkDB All DBs
Position
165257..165874
Genome map
AA seq 205 aa AA seqDB search
MSETAAPTSAGASAEAEVVAALGRHSVVLIGMMGAGKSTVGRRLAVRLGLPFVDADTEIE
AAAGMTIPEIFETHGEPHFRDGEARVIARLLEGGPHVLATGGGAFMREETRARIAAHGVS
LWLQADADVILRRVKRRADRPLLKTADPAATIARLIDERHPMYQTAEITIASRDVPHDKI
VDECVEALHHHLYRAEAAPTTSETR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaaccgcggctccaaccagcgccggcgcctctgccgaggccgaggtcgttgct
gcgctgggccggcactcggtggtgctgatcggcatgatgggggccggcaaatccaccgtc
gggcgacggctggcggtgcggctcgggctgcccttcgtcgacgccgacaccgagatcgaa
gccgcagccggcatgaccatcccggaaattttcgagacccatggcgagccgcattttcgc
gatggcgaggcgcgggtgatcgcgcggctgttggagggcggcccccacgtgctggcgacc
gggggcggcgccttcatgcgcgaggagaccagggcgcggatcgcggcgcacggcgtctcg
ctgtggctgcaggccgacgccgacgtgatcctgcgccgggtcaagcgccgcgccgaccgg
ccgctgttgaaaacggccgaccccgccgcgaccatcgcccggctgatcgacgaacgtcac
ccgatgtaccagaccgccgagatcaccattgcctcgcgcgacgtgccgcacgacaagatc
gtcgacgaatgcgtcgaggcgctgcatcaccacctctaccgcgccgaggcggcgccaacc
acaagcgagacaagatga

DBGET integrated database retrieval system