KEGG   Rhodopseudomonas palustris BisA53: RPE_0615
Entry
RPE_0615          CDS       T00400                                 

Definition
(GenBank) cyclohex-1-ene 1-carbonyl-CoA hydratase
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00362  Benzoate degradation
rpe01100  Metabolic pathways
rpe01120  Microbial metabolism in diverse environments
rpe01220  Degradation of aromatic compounds
Module
rpe_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:rpe00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPE_0615
Enzymes [BR:rpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     RPE_0615
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: ABJ04573
UniProt: Q07U11
LinkDB
Position
680445..681221
AA seq 258 aa
MAENVIVVEQEGRVGLITLNRPEVLNALNDELMDALGRALLAFDADDGIGAIVIAGSARA
FAAGADIAVMAEWSYSDVYRSNFVTRNWETIRQVRKPVLAAVAGLAYGGGCELALACDII
VAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSGRPLDADEADRYGLVSRV
VEDDKLREETLKLATTIAAFSAPALMVLKETLNRAFETTLSEGILFERREMHARFAAPDA
REGIKAFLEKRKPSFAHR
NT seq 777 nt   +upstreamnt  +downstreamnt
gtggcagagaacgtgatcgtcgtcgaacaagaaggccgggtcgggctcatcacgctcaac
cgcccggaagtgctcaacgcgctcaacgacgaattgatggatgcgctcggccgcgcgctg
ctcgctttcgatgccgacgacggcatcggcgcgatcgtgatcgccggcagcgcgcgggca
tttgccgcgggtgccgacatcgccgtgatggcggagtggagctatagcgacgtctacaga
tcgaacttcgtcactcgcaattgggagacgatccggcaggtgcgcaagccggtgctggcc
gcggtcgcgggtcttgcctatggcggcggctgcgaattggcgttggcctgcgacatcatc
gtcgccgcgcgcagcgccaaatttgcgctccccgaaatcaagctcggcctgttgccgggc
gccggcggcacgcagcggctgccgcgcgccatcggcaaggcgaaggcgatggacatgtgc
ctgtccggccgtccgctcgatgccgacgaggccgaccgctacggcctggtgtcgcgcgtg
gtcgaggacgacaagctccgcgaagaaaccttgaagctcgcaaccaccatcgccgcgttc
tcggccccggcgctgatggtgctgaaggagacgctcaatcgcgccttcgaaacgacgctg
agcgagggaattctgttcgaacggcgcgaaatgcatgcccgcttcgcggcgccggatgcc
cgcgaaggcatcaaagcgttcctggagaagcgcaagccgagctttgcccaccgctga

DBGET integrated database retrieval system