KEGG   Rhodopseudomonas palustris BisA53: RPE_1264Help
Entry
RPE_1264          CDS       T00400                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00910  Nitrogen metabolism
rpe02010  ABC transporters
Module
rpe_M00438  Nitrate/nitrite transport system
rpe_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:rpe00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    RPE_1264
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RPE_1264
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpe02000]
    RPE_1264
Transporters [BR:rpe02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    RPE_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABJ05216
UniProt: Q07S68
LinkDB All DBs
Position
complement(1428771..1429670)
Genome map
AA seq 299 aa AA seqDB search
MTMPALDSKSLAVVPTAPTPAPVVAIKPRRQPRAERYGKLAREVAARVIPPLIVIVFSMV
IWELICRRTGSTLPPPSKVYSDTKELIFDPFFDRGGIDKGLFWHLSASLQRVAFGYSLAA
VAGIGLGVLVGQSVWAMRGLDPIFQVLRTIPPLAWLPLALAAFRDGQPSAIFVIFITSIW
PIIINTAVGIRNIPQDYRNVAAVVRLNPLEFFWKIMLPSAAPYIFTGLRIGVGLSWLAII
AAEMLIGGVGIGFFIWDAWNSSHISEIILALFYVGIIGFVLDRAIAGLGRLVTHGTSAG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgcccgccctcgacagcaaatccctcgcggtggtccccacggcgccgacgccg
gcgcccgtggtggcgatcaagccgcgccgccagccgcgcgccgagcgctacggcaagctc
gcgcgcgaggtcgccgcccgcgtgatcccgcccctgatcgtgatcgtgttctcgatggtg
atctgggaactgatctgccgccgcaccggctcgacgctgccgccaccgtccaaggtctat
agcgacaccaaggaactgatcttcgatccgttcttcgatcgcggcggcatcgacaagggg
ctattctggcacctgtcggcctcgctgcagcgcgtcgctttcggctattcgctggccgcg
gtcgccggcatcggtctcggcgtgctggtcgggcaatcggtgtgggcgatgcgcgggctc
gatccgatcttccaggtgctgcgcaccattccgccgctggcctggctgccgctggcgctc
gccgcattccgcgacggccagccctcggcgatcttcgtgatcttcatcacctcgatctgg
ccgatcatcatcaacaccgcggtcggcatccgcaacattccgcaggattatcgcaacgtc
gccgctgtggtgcggctcaatccgctggaattcttctggaagatcatgctgccctcggcc
gcgccttacatcttcaccggcttgcggatcggcgtcgggctgtcgtggctggcgatcatc
gccgccgaaatgctgatcggcggcgtcggcatcggcttcttcatctgggacgcttggaat
tcctcgcatatcagcgagatcatcctggcgctgttctatgtcggcatcatcggcttcgtg
ctcgaccgcgccatcgcgggcctcgggcgcctcgtcacccatggcacctcggccggttaa

DBGET integrated database retrieval system