KEGG   Rhodopseudomonas palustris BisA53: RPE_1378Help
Entry
RPE_1378          CDS       T00400                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00564  Glycerophospholipid metabolism
rpe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    RPE_1378
Enzymes [BR:rpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RPE_1378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_3 FAD_binding_2 Pyr_redox_2 Pyr_redox NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABJ05330
UniProt: Q07RV4
LinkDB All DBs
Position
1550650..1552194
Genome map
AA seq 514 aa AA seqDB search
MGQIFDLAIIGGGINGCGIARDAAGRGNSVFLCEMNDLASGTSSWSTKLIHGGLRYLEYF
EFRLVREALIERERLWKIAPHIIRPLRFVLPHHDGLRPAWRLRLGLLLYDYIGGRKLLPP
TRTVDLATAEVGKPLIPGRFARGFEYSDCFVDDARLVLLTARDAADRGAEIRTRSRAVDI
RQFDNVWHVSVEDARSGRRETIQARVLINAAGPWVENVLAVGSGVQSQVKVRLVQGSHIV
VRKLYDHDRAYIFQNADGRIVFAIPYQDDFTLIGTTDRDYEGDPAKVTASPEEIAYLCEA
VSAYLAKPVTPADVVWTFSGVRPLYDDGASDAKAATREYLFELDRPNNGAPLLSIFGGKI
TTYRRLAEEALDKLAPFLRGAAAPEGWTANAPLPGGDFDVAGIDAQIAALRRDYPFLGEA
HARRLVGAYGTSARKMLGDASSMADLGRAFGATLTERELRYLVAQEWATTAEDVVWRRSK
LGLRLSTEEIAAIEDWMVEQRNGTAAPRKAGGLA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgggtcaaatctttgacctcgcaatcattggcggcggcatcaacggctgcggcatcgcg
cgcgacgcggccggtcgcggtaattcggtgttcctttgcgagatgaacgatctcgccagc
ggcacctcgtcctggtcgaccaagctgatccatggcgggctgcgctatctcgaatacttt
gaattccggctggtgcgcgaggcgctgatcgagcgcgagcggctgtggaagatcgcgccg
catatcatccggccgctgcgtttcgtgctgccgcatcacgacggcttgcggccagcatgg
cggctgcggctcgggctgctgttgtacgactacatcggcgggcgaaagctgctgccgccg
acccgcacggtcgatctcgccaccgcggaagtcggcaagccgctgatccccggacgcttc
gcccgcggctttgaatattccgattgttttgtcgatgacgcgcgcctcgtgctgctcacc
gcgcgcgatgccgctgatcgcggcgccgagattcgcacccgcagccgtgccgtggacatt
cgccagttcgacaatgtctggcacgtcagcgtggaagacgcccgctcagggcgccgcgag
accatccaggcgcgcgtgctgatcaatgccgccggcccctgggtggagaatgtgctggcc
gtgggatccggcgtgcagtcccaggtcaaggtgcggctggtgcagggctcgcacatcgtg
gtgcgcaaactctacgaccacgaccgcgcctacatcttccagaatgccgacggaaggatc
gtgttcgcgatcccctatcaggatgacttcacgctgatcggcaccaccgatcgcgattac
gagggcgatccggccaaggtgacggcatcgcccgaggagatcgcttatctctgcgaggcg
gtcagcgcctatctcgcaaaaccggtgacgccggccgacgtggtgtggaccttttccggc
gtacggccgctctatgacgacggcgccagcgacgccaaggcggcgacccgcgaatatttg
ttcgagctcgaccggccgaataacggcgcgccgctgctcagcatttttggcggcaagatc
accacctatcgccggctcgccgaggaagcgctggacaagctcgcgccgtttttgcgcggc
gccgcggcgcccgaaggctggaccgcgaacgcgccgctgccgggcggcgatttcgacgtg
gctgggatcgacgcgcaaatcgctgcgttgcgccgcgactatccgtttctcggcgaggcg
catgcacggcggctggtcggcgcctacggcaccagcgcccgcaagatgctcggcgatgcc
tcgtcgatggccgatctcggccgcgccttcggcgcgacgctgaccgagcgggaactgcgc
tatctggtcgcgcaggaatgggccaccacggcggaggatgtggtgtggcgtcgctccaaa
ctgggtttacgattgtcgacggaggagatcgccgcgatcgaggactggatggtcgaacag
cgtaacggcacggccgctccccgcaaggccggaggcctggcgtga

DBGET integrated database retrieval system