KEGG   Rhodopseudomonas palustris BisA53: RPE_2113Help
Entry
RPE_2113          CDS       T00400                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00473  D-Alanine metabolism
rpe00550  Peptidoglycan biosynthesis
rpe01100  Metabolic pathways
rpe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rpe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RPE_2113
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RPE_2113
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    RPE_2113
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rpe01011]
    RPE_2113
Enzymes [BR:rpe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RPE_2113
Peptidoglycan biosynthesis and degradation proteins [BR:rpe01011]
 Precursor biosynthesis
  Amino acid ligase
   RPE_2113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 GARS_A CPSase_L_D2 SEEK1
Motif
Other DBs
NCBI-ProteinID: ABJ06057
UniProt: Q07PS7
LinkDB All DBs
Position
2328865..2329791
Genome map
AA seq 308 aa AA seqDB search
MTKRKHVAVLLGGWSSEREVSLRSGNACADALERRGFEVTRIDVARDIATVLDQLRPDSA
LMMLHGHPGEDGSIQGVLETLAIPYSHSGVLASALAMQKDLAKTVMKTAGVPVAEGLTLS
RDEIARGHVMEPPYVIKPVADGSSVGVYIITEQHQHPPQELFRDDWAYGDKLLVEKYVAG
KELTCAVVKGEPTDVIEIVPMVRFYDYEAKYSPGASKHVLPASLLPFVYQEVRRLTLAAH
VALGCRGVSRADFRFDDRIEGTGGLVCLEVNTQPGMTETSLVPELAAYAGITFDELVQWM
VEDASLDR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaacgcaagcacgtcgccgtactgctcggaggctggtcatccgagcgggaggtc
tcgctgcgctccggcaacgcctgcgccgatgcgctggagcgccgcggctttgaggtgacc
cggatcgacgtcgcgcgcgacatcgccaccgtgctcgatcaattgcgtccggactcggcg
ctgatgatgctgcacggccatccgggcgaggacggcagcattcagggggtgctggagacc
ctcgccattccctacagccattccggcgtgctggcctcggcgctggcgatgcagaaggac
ctcgccaaaaccgtcatgaagacggccggtgtcccggtggcggaagggctgacgctgtcg
cgggacgagatcgccaggggccacgtgatggaaccgccctatgtcatcaagccggtggcc
gatggctccagcgtcggtgtgtacattattaccgaacagcaccagcacccgccgcaggaa
ctgttccgcgacgactgggcctatggcgacaagctgctggtggagaaatacgtcgccggc
aaggaactcacctgtgccgtggtcaagggcgagcccaccgacgtgatcgagatcgtaccg
atggtccggttttacgattacgaggcaaagtattctcccggcgcgtcaaaacacgttctg
cctgcatctcttttaccatttgtttaccaggaggtccgaaggttaacgctggcggcgcat
gtggcgctcggctgccggggcgttagccgggcggatttccgcttcgacgaccgcatcgag
ggaacaggcggcctcgtctgccttgaggtcaacacccaacccggaatgaccgagacgtca
cttgtgccagagctcgcagcgtatgcgggcataacatttgacgagctcgtgcaatggatg
gtggaagacgcctcgctcgatcgctga

DBGET integrated database retrieval system