KEGG   Rhodopseudomonas palustris BisA53: RPE_2616Help
Entry
RPE_2616          CDS       T00400                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00010  Glycolysis / Gluconeogenesis
rpe00020  Citrate cycle (TCA cycle)
rpe00620  Pyruvate metabolism
rpe01100  Metabolic pathways
rpe01110  Biosynthesis of secondary metabolites
rpe01120  Microbial metabolism in diverse environments
rpe01130  Biosynthesis of antibiotics
rpe01200  Carbon metabolism
Module
rpe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPE_2616
   00020 Citrate cycle (TCA cycle)
    RPE_2616
   00620 Pyruvate metabolism
    RPE_2616
Enzymes [BR:rpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RPE_2616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N GCV_H Fas_alpha_ACP
Motif
Other DBs
NCBI-ProteinID: ABJ06554
UniProt: Q07ND0
LinkDB All DBs
Position
2888307..2889662
Genome map
AA seq 451 aa AA seqDB search
MPINILMPALSPTMEKGNLAKWLKKEGDSVKSGDVIAEIETDKATMEVEAVDDGTIARIV
VPEGTQDVAVNDIIAVLASEGEDIKAAGAAKPEAAKQEAPKPQPSASSVEAPAAPAAQDD
AKAPRPAQGAPAPIPTGDASHSNGRNFSSPLARRLAKDAGIDIGRVTGSGPHGRVIARDV
EQAKAGGGPKAPAAAPSSAPAIAPSLSDQQIRGFFQEGSFDETPHDSMRKIIAQRLVQAK
QTIPHFYLTMDCNLDRLMAAREQINASAPKDKDGKPAYKLSVNDFVIKALALALQRVPDA
NVTWTEGAMLKHRASDVGVAVSIPGGLITPVVRDAHLKSVSTISREMKDFAARARNRRLK
PEEYQGGSTAVSNLGMFGIKDFAAVINPPHATILAVGAGEQRAVVIDGKVEVATIMSATL
STDHRAVDGALGAELLGAFKLLIENPVMMVV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacatcctgatgcccgcgctctcgccgacgatggagaagggcaatctcgcc
aaatggctgaagaaggaaggggacagcgtcaaatccggcgacgtgatcgccgagatcgag
accgacaaggcgaccatggaggtcgaagcggtcgacgacggaacgattgcaagaattgtg
gtgccggaaggcacccaggacgtggcggtcaacgacatcatcgcggtgctggcctccgag
ggcgaggacatcaaggcggcgggggcggccaagccggaggccgcaaaacaggaagcgccg
aagccgcagccatccgcgtcatcggtcgaggcccccgctgcgccggcggctcaggatgac
gccaaagcgcctcgacctgcgcagggcgcgccagcgccaatcccgaccggcgatgcttcg
cattccaacggccgcaacttctcatcgcccttggcccgtcgtctcgccaaggacgccggc
atcgatatcggccgcgtcaccggcagcggcccgcacggccgcgtcattgcccgcgacgtc
gagcaggcgaaagccggcggcgggccgaaggcgccggctgccgcgccgtcgtccgcgccg
gcgatcgcgccgtcgctgtcggatcagcagatccgcggcttcttccaggaaggcagcttt
gacgagaccccgcacgacagcatgcgaaaaatcatcgcgcagcggctggtgcaggccaag
cagaccatcccgcatttctatctgaccatggactgcaacctcgaccgcctgatggccgcg
cgcgagcagatcaatgcatcggcgccgaaggacaaggacggcaagccggcctacaagctc
tcggtcaacgacttcgtcatcaaggcgctggcgctggcgctgcagcgcgtgcccgacgcc
aatgtcacctggaccgagggggcgatgctcaaacatcgcgcttctgacgtcggcgtcgcg
gtgtcgatcccgggcgggctgatcacgcctgtggtgcgcgacgcgcatctcaaatcggtg
tcgaccatctcgcgcgagatgaaggattttgccgcccgcgcccgcaaccgaaggctgaag
cccgaggaatatcagggcggctcgaccgcggtgtccaatctcggcatgttcggcatcaag
gattttgccgcggtgatcaacccgccgcatgcgacgatcctggcggtcggcgccggcgaa
caacgcgcggtggtgatcgatggcaaggtcgaggtcgccaccatcatgagcgccacgctc
tccaccgaccaccgcgccgtcgacggcgcactcggcgcggagctgctgggtgcgttcaag
ctgctgatcgaaaatcccgtgatgatggtggtgtga

DBGET integrated database retrieval system