KEGG   Rhodopseudomonas palustris BisA53: RPE_2693Help
Entry
RPE_2693          CDS       T00400                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00520  Amino sugar and nucleotide sugar metabolism
rpe01100  Metabolic pathways
rpe01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RPE_2693
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    RPE_2693
Enzymes [BR:rpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RPE_2693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ABJ06630
UniProt: Q07N54
LinkDB All DBs
Position
3016626..3017654
Genome map
AA seq 342 aa AA seqDB search
MIKKRAFITGIAGTTLTAEEREFIRSALPWGLILFKRNIDNPKQVTKLVSEFRKEIGDAD
APVLIDQEGGRVQRLAPPHWPAYPAGALFSSLYDIDSQLGLSAAWLSARLIAADLAELGI
TVDCLPLADVPVAGADAVIGDRAYGTDQAKVAAIAQSVADGLTQGGVLPVLKHIPGHGRA
TADSHLRLPVVDVSEEELDQTDFSPFQTLSALPMAMTAHVVFSAIDPAQPATTSATIIER
VIRGLIGFQGLLMTDDVSMNALAGSIAERCRASLAAGCDVVLHCNGKIDEMREVAAAVPM
LSGMAAQRAAHALALRRPPEPFDRIEAREQLDELIRRAGADA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaagcgcgcatttattaccggaatcgcaggaaccactttgaccgccgaggaa
cgcgagttcatccggtcggctttgccgtggggccttatcctcttcaagagaaacatcgat
aatccgaagcaagttacgaaacttgtttctgaatttcgcaaagagatcggcgatgcggat
gccccggtcctgatcgaccaggaaggcggacgggtgcagcggctggcgccgccgcattgg
ccggcctatccggcgggggcgctgttcagctcactctacgatattgattcacagcttggg
ctctccgctgcctggctcagcgcgcggctcatcgccgccgatctggccgaactcgggatc
acggtcgattgtctgccgctggccgacgtgccggttgccggcgccgacgcggtgatcggc
gatcgcgcctacggcaccgatcaggccaaggtggccgcgatcgcccaatcggtggcggat
gggctgacgcagggcggggtgctgccggtgctgaagcatattcccggccacggtcgggcc
accgctgatagccaccttcggcttccggtggtcgatgtgtcggaagaagaactcgatcag
accgacttctcgccgttccagacgctttcggcgctaccgatggcgatgaccgcacatgtt
gtgttcagcgcgatcgatcccgcccaacctgcgaccacttctgcgacaatcatcgaacgc
gtgattcgtggcctgatcgggttccagggactgttgatgaccgacgacgtgtcgatgaat
gccttggccggcagcattgccgagcgctgtcgcgccagccttgcggcgggatgcgacgtg
gttctgcactgcaacggcaagatcgacgaaatgcgcgaggtcgccgccgccgtgccgatg
ttgagcgggatggccgcgcagcgcgccgcgcacgcgctcgccttgcgtcgcccgcccgag
ccgttcgatcgcatcgaggcgcgcgagcagctcgacgaactgatccgtcgcgccggagcg
gatgcatga

DBGET integrated database retrieval system