KEGG   Rhodopseudomonas palustris BisA53: RPE_3356Help
Entry
RPE_3356          CDS       T00400                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00970  Aminoacyl-tRNA biosynthesis
rpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpe00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RPE_3356
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rpe03029]
    RPE_3356
Enzymes [BR:rpe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RPE_3356
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RPE_3356
Mitochondrial biogenesis [BR:rpe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RPE_3356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ABJ07288
UniProt: Q07L96
LinkDB All DBs
Position
complement(3751314..3752798)
Genome map
AA seq 494 aa AA seqDB search
MNAPVKPSKLIKGATGDWEVVIGLEVHAQVASNAKLFSGASTEFGGAPNAHVSLVDAAMP
GMLPVINEECVAQAVRTGLGLNAQINLRSVFDRKNYFYPDLPQGYQISQYKSPVVGEGVV
EVDLPDGEGISVGIERLHLEQDAGKLLHDQHPTSTFVDLNRSGVALMEIVSKPDIRSSEQ
AKAYVSKLRTILRYLGTCDGDMEKGSLRADVNVSVRKPGGPLGTRCEIKNVNSIRFIGQA
IEYEARRQIGILEDGGAIVQETRLFDAGKGETRSMRSKEEAHDYRYFPDPDLLPLEFSQD
YVDALKAKLPELPDAKKARFMAEFGLSLEDAGVLVAERESAEFYEAVLAALGNQPRDGKL
AANWVINELFGRLNKEGRDIAASPVSAAQLATIVELIGEGTISGKIAKDLFEIVWCEGGD
PRELVETRGMKQVTDLGAIEKVVDDIIQANPDKVAQAQAKPALMGWFVGQVMKSSGGKAN
PQSVNDLLKSKLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacctgtcaaaccctcaaaactcatcaagggcgccaccggcgattgggaagtc
gtgatcgggctggaagtccacgcccaggtcgcctccaacgccaaattgttttccggcgcc
tcgaccgaattcggcggcgcgccgaacgcccacgtctcgttggtcgacgccgcgatgccg
gggatgctgccggtgatcaacgaggagtgcgtcgcccaggcggtccgcaccgggctcggg
ctgaacgcgcagatcaacctgcgctcggtgttcgaccgcaagaactatttctatccggac
ctgccgcagggctaccagatcagccaatacaaatcgccggtggtcggcgaaggcgtggtc
gaggtcgatctgccggacggcgagggcatcagcgtcggcatcgagcggctgcatctggaa
caggacgccggcaaattgctgcatgatcagcacccgacgtcgaccttcgtcgatctcaac
cgctccggcgtggcgctgatggagatcgtctccaagccggacatccgctcctcggaacag
gccaaggcctatgtctccaagctgcgcaccatcctgcgctatctcggcacctgcgacggc
gacatggagaaggggagtctccgcgccgacgtcaacgtctcggtgcgcaagcccggcggc
ccgctcggcacccgttgcgagatcaagaacgtcaattcgatccgcttcatcggccaggcg
atcgagtacgaggcgcgccgtcagatcggcattctggaggacggcggcgccatcgtgcag
gaaacccggctgttcgacgccggcaagggcgagacgcggtcgatgcgctccaaagaagag
gcgcatgattatcgctatttccctgacccggacctgctgccgctggagttttcccaggac
tacgtcgacgcgctgaaggccaaactgccggaactgccggacgccaagaaggcgcggttc
atggctgagttcggcctgtcgctggaggacgccggcgtactggtggccgagcgcgagagc
gcggagttctatgaagcggtgctcgccgcactcggcaaccagccgcgcgacggcaagctg
gcggcgaattgggtgatcaacgagttgttcggccggctcaacaaggaaggccgcgacatc
gccgcctcgccggtgtcggcggcgcaactcgcgaccatcgtcgaactgatcggcgaggga
accatctccggcaagatcgccaaggatctgttcgagatcgtctggtgtgagggcggcgat
ccgcgcgaactggtcgagacgcgcggcatgaagcaggtcaccgatctcggcgcgatcgag
aaggtggtcgacgacatcatccaagccaatcccgacaaggtggcgcaggcgcaggccaag
ccggcgctgatgggatggttcgtcggtcaggtgatgaagtcgtccggcggcaaggccaat
ccgcaatcggtcaacgacctcctgaagagcaaactcggtctctga

DBGET integrated database retrieval system