KEGG   Rhodopseudomonas palustris BisA53: RPE_3588Help
Entry
RPE_3588          CDS       T00400                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
rpe  Rhodopseudomonas palustris BisA53
Brite
KEGG Orthology (KO) [BR:rpe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rpe03012]
    RPE_3588
   03029 Mitochondrial biogenesis [BR:rpe03029]
    RPE_3588
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpe04147]
    RPE_3588
Translation factors [BR:rpe03012]
 Eukaryotic Type
  Elongation factors
   RPE_3588
 Prokaryotic Type
   RPE_3588
Mitochondrial biogenesis [BR:rpe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RPE_3588
Exosome [BR:rpe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RPE_3588
  Exosomal proteins of breast cancer cells
   RPE_3588
  Exosomal proteins of colorectal cancer cells
   RPE_3588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: ABJ07518
UniProt: Q07KJ2
LinkDB All DBs
Position
complement(3998504..3999694)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKCDMVDDPELLELVEMEVRELLSKYDFPGDDIPIIKGSALAALE
NKDPKLGHDAILELMKAVDSYIPQPERPIDQPFLMPVEDVFSISGRGTVVTGRVERGIIK
VGEEIEIVGLRDTVKTTCTGVEMFRKLLDQGQAGDNIGALLRGTKREEVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNIA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcaaagtttgaacgtaataagccgcattgcaacatcggtacgattggtcac
gtcgaccatggcaagacgtcgctgacggcggcgatcaccaaggttctggcggagacgggc
ggcgcgacgttcacggcctatgaccagatcgacaaggcgccggaagaaaaggcgcgcggc
atcacgatttcgacggctcacgtcgaatacgagaccgccaaccggcactacgcccacgtc
gactgcccgggccacgccgactacgtcaagaacatgatcaccggcgcggcgcagatggac
ggcggcattctggtcgtctccgcggccgacggcccgatgccgcagacccgcgagcacatc
ctgctcgcccgccaggtcggcgtgccggcgctggtggtgttcctgaacaagtgcgacatg
gtcgacgatccggaactgctcgagttggtcgagatggaagttcgcgaacttctgtcgaag
tacgacttcccgggcgacgacattccgatcatcaagggttcggctcttgcggcccttgaa
aacaaggatccgaagctcggtcacgacgcgatcctggaactgatgaaggcggtcgacagc
tacatcccgcagccggagcgtccgatcgatcagccgttcctgatgccggtggaagacgtg
ttctcgatctccggtcgcggcaccgtggtgaccggtcgcgtcgagcgtggcatcatcaag
gtcggcgaggaaatcgagatcgtcggtctgcgcgacaccgtgaagaccacctgcaccggc
gtcgaaatgttccgcaagctgctcgaccagggccaggccggcgacaacatcggcgcgctg
ctgcgcggcaccaagcgcgaggaagtcgagcgcggtcaggtgctgtgcaagccgggttcg
gtgaagccgcacaccaaattcaaggctgaggcctacatcctcaccaaggaagagggcggt
cgtcacactccgttcttcaccaactatcgtccgcagttctacttccgcaccaccgacgtc
accggcgtcgtgcatctgccggaaggcaccgagatggtgatgccgggcgacaacatcgcg
atggaagtgcacctgatcgtgccgatcgcgatggaagagaagctgcgcttcgcgatccgt
gaaggtggccgcaccgtcggcgccggcgtggtggcctcgatcatcgagtaa

DBGET integrated database retrieval system