KEGG   Ralstonia pickettii 12D: Rpic12D_1403Help
Entry
Rpic12D_1403      CDS       T00925                                 

Definition
(GenBank) Aldehyde Dehydrogenase
Organism
rpf  Ralstonia pickettii 12D
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACS62691
UniProt: C6BHT4
LinkDB All DBs
Position
1:1481335..1482771
Genome map
AA seq 478 aa AA seqDB search
MQQRDKLFINGKWVAPQGKGVIEVIHSATEAVMGTIPEGSAADAEAAVAAARAAFDDWAA
TPVAKRAEYIQKIADGLHARSEELAQLIAGEVGMPIKLARAIQVGGPVYNWSNFAKLLST
FEFEEQVGNSLVVREPVGVVGAITPWNYPLNQITLKVAPALAAGCTVVLKPSEVAPLNAF
VLAEVIEEAGLPPGVFNLVTGYGPVVGEVLASDPEVDMVSFTGSTRAGKRVAELASQSVK
RVALELGGKSASVILDDADLASAVKGTLSACFLNSGQTCSAHTRMLVPRAKYEEVKALAA
QFAAAYVPGDPAQESTRLGPLISAVQRDRVLGYIRKGLEEGAELITGGADTPEGLTTGYF
VKPTVLGNVKTTDTVAREEIFGPVLTVICYDDEEEAVRIANDSIYGLGGGVWSGDESRAI
RVARRIRTGQVNINGGPFNMQAPFGGYKQSGNGRENGKYGLEEFLEYKALQLNPAKTA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaacgcgacaagctttttatcaatggcaagtgggtggcgccgcagggcaagggc
gtcattgaagtgattcattcggccacggaagccgtgatggggaccattcccgaaggcagc
gcggccgatgccgaagcggccgtggctgcggcgcgcgccgcatttgatgactgggctgcc
acgcccgtggccaagcgcgccgagtacatccagaagattgccgacggcctgcatgcccgc
agcgaagaactggcgcagctgattgccggtgaagtcggcatgccgatcaagttggcgcgt
gccatccaggtgggcggccccgtctacaactggagcaatttcgccaagctgctcagcacg
tttgaatttgaagagcaggttggcaactcgctggtggtgcgcgagcccgtgggtgtggtg
ggcgccatcacgccgtggaactacccgctcaaccagatcacgctgaaggttgcgcccgcg
ctggcggccggctgcacggtggtgctcaagccgtcggaagtggcgccgctcaacgcgttc
gtgttggcggaagtcattgaagaagccggcctgccgccgggcgtgttcaaccttgtcacc
ggctatggcccggtggtaggcgaggtgctggcaagcgacccggaggtcgacatggtgtcg
ttcacgggctccacgcgtgcgggcaagcgcgtggcggaactcgcatcgcagtcggtcaag
cgggtggcgctggagctgggcggcaagtcggcctcggtgatcctggatgacgcggacctg
gcatcggcggtcaagggcacgctgtcggcgtgtttcctgaactccgggcagacgtgttcc
gcgcacacgcgcatgctggtcccgcgtgccaaatacgaagaagtgaaggcgctggccgcg
cagtttgccgctgcgtacgtgccgggcgatccggcgcaggaaagcacgcgtctggggccg
ctgatctccgccgtgcagcgcgaccgcgtgctgggctacatccgcaaggggctggaagag
ggcgcggaactcattaccgggggcgccgacacgcccgaaggcctgactaccgggtacttc
gtcaagccgacggtgctgggcaacgtcaagaccaccgacaccgtcgcgcgcgaagaaatc
ttcggccctgtgctgaccgtcatctgctacgacgacgaggaagaggccgtccggattgcc
aacgacagcatctacggcttgggcggcggtgtgtggtcgggcgacgagagccgcgcgatt
cgcgtggcgcggcgcatccgcacgggccaggtcaatatcaacggcgggccgttcaacatg
caggcaccgtttggcggctacaagcaatccggcaacgggcgggaaaacggcaagtacggc
ctggaggagttcctggagtacaaggcgctgcaactcaatcccgccaagacggcctga

DBGET integrated database retrieval system