KEGG   Ralstonia pickettii 12D: Rpic12D_2167Help
Entry
Rpic12D_2167      CDS       T00925                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00620  Pyruvate metabolism
rpf00680  Methane metabolism
rpf01100  Metabolic pathways
rpf01120  Microbial metabolism in diverse environments
rpf01200  Carbon metabolism
Module
rpf_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpic12D_2167
  09102 Energy metabolism
   00680 Methane metabolism
    Rpic12D_2167
Enzymes [BR:rpf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Rpic12D_2167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 AAA_22
Motif
Other DBs
NCBI-ProteinID: ACS63441
UniProt: C6BBI5
LinkDB All DBs
Position
1:2306436..2309444
Genome map
AA seq 1002 aa AA seqDB search
MTQPAARRASSRATTARKASAAPAKTSKATKAIKAAKPAAKPVATANGADEANGASLGPT
SRRSSGSAAAKDQPLKEDIRFLGRLLGDVLREQEGGAAFETVETIRQTAVRFRRDGDRQA
EQELDRLLKALSREQTNSVVRAFSYFSHLANIAEDQHHNRRRRVHALAGSPPQPGSMMRA
LLSVADEGVSGETLRRFFDAALIVPVLTAHPTEVQRKSILDAQREIARLLAERDTPLTTR
ERERNTTLLRAHVTKLWQTRMLRTTRLMVADEIENALSYYQTTFLREIPALYRELEEDVA
AVFPRRGARGEPTPLAPFFQMGSWIGGDRDGNPFVTAETLRYAARKQASVILAWYLEEIH
ALGAELSMSTSQVDVSAELLALAEQSPDRSEHRSDEPYRRALIGVYARLAATCRELTGED
AGRHAVGPAPAYSNAEELRADIQIVIDSLAAHHGEVLADARLASLARAIDVFGFHLSSID
LRQVSDVHEATVAELLKVAGVEGAYAALSEADKRTLLLRELQQPRVLTLPFHAYSEQTTS
EIDIFRAAREVRARYGNRIVRNYIISHTETLSDLLEVMLLQKEAGMFRTGANGSGSAALD
VMVIPLFETIEDLRNAPEIMGDLLDLPGFDAVLAAQGNEQEVMLGYSDSNKDGGFLTSNW
ELYKAELALVELFQRKGVRLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGE
IISSKFANPEIGRRNLETIVAATLEATLLPTRNRPKGLEEFEAAMQALSDNAFAAYRNLV
YETPGFKDYFFATTPITEIADLNLGSRPASRKLMDKKHRRIEDLRAIPWGFSWGQCRLLL
PGWFGFGSAVQRWLDDAGNAKARAARLTTLKRMHKQWPFFANLLSNMDMVLSKADLNVAS
RYAQLCDDRKLRNAVFSRISAEFTLTEQMLAAITGQSERLADNPLLARSIKNRFPYLDPL
NHLQVELLKRFRSGKAGSDDARVRRGIHLSINGIAAGLRNSG
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcccgccgcgcgccgcgcttcctcgcgcgcgacaaccgcccgcaaggcttcc
gccgctcccgccaagaccagcaaggccacgaaggccatcaaggctgccaagcccgccgcc
aaaccggtggccacggccaatggcgcggacgaagccaatggcgcatcactcggccccact
tcccggcgctcgtcgggcagcgccgcggccaaggatcagccgctgaaggaagacatccgc
ttcctcgggcgcctgctgggcgacgtgctgcgtgaacaggaaggtggcgccgccttcgaa
accgtcgagacgatccgccagaccgccgtgcgtttccgccgcgacggcgaccgccaggcc
gagcaggaactcgaccgcctgctgaaagccttgtcgcgtgagcaaaccaactccgtggtg
cgcgcgttcagctacttctctcacctggccaacattgccgaagaccagcaccacaaccgc
cgccgccgcgtgcatgcgctggcgggctcgccaccgcagccgggcagcatgatgcgcgcg
ctgctgtcggtggccgacgagggtgtctcgggtgagacgctgcgccgcttcttcgatgcc
gcgttgatcgtgcccgtgctcacggcccacccgaccgaggtgcagcgcaagagcattctc
gatgcacagcgtgaaatcgcccgcctgctggccgaacgcgacacgccgctgaccacccgc
gagcgtgaacgcaacacgacgctgctgcgcgcgcacgtgaccaaactgtggcagacacgc
atgctgcgcaccacgcgtctgatggtggccgacgagatcgaaaacgcgctgtcgtactac
cagacgacgttcctgcgcgagattcccgcgctgtaccgcgaactggaagaggacgtcgct
gccgtattcccgcgccgtggcgcacgtggcgaacccaccccgttggcgccgttcttccag
atgggctcgtggatcggcggcgaccgcgacggcaaccccttcgtcacggcagaaaccctg
cgctacgccgcccgcaagcaggccagcgtgatccttgcgtggtatctggaagagatccac
gcgctgggcgccgaactgtcgatgtcgacatcgcaggtggatgtgagtgctgaattgctg
gcgctggcggagcagtcgcccgatcgatcggagcatcgctcggatgagccataccgccgt
gcgctgatcggggtctatgcgcgactggccgccacctgccgtgagctgaccggtgaagac
gccggccgccacgccgtcgggcccgctccggcttacagcaacgcagaagaactgcgcgcc
gacatccagatcgtgatcgattcattggcggcgcaccacggcgaagtgctggccgatgcg
cgactggcatcgctggcgcgcgcgatcgatgtgttcggcttccacctgtcgtcgatcgac
ctgcggcaagtgtcggacgtgcacgaagcgaccgtcgccgagctgctgaaagtggccggt
gtggaaggcgcctatgctgcgctgtccgaggccgacaagcgcacgctgctgttgcgcgag
ctgcaacagccgcgcgtgctgacgctgccgttccatgcctacagcgagcagaccacgtcg
gagatcgacatcttccgcgctgcccgtgaggtgcgcgcccgctacggcaatcgcatcgtg
cgcaactacatcatttcgcacaccgagacgctgtccgacttgctcgaagtgatgttgctg
cagaaggaagccggcatgttccgcacgggcgccaatggcagcggcagtgccgcgctggac
gtcatggtgatcccactgttcgaaaccatcgaagacttgcgcaacgccccggaaatcatg
ggcgacctgctcgatctgcccggcttcgatgccgtactggccgcgcaaggcaacgagcag
gaagtcatgctcggctattcggattccaacaaggacggcggcttcctcacttctaactgg
gagctctacaaggccgaactggcgctggtggagctgttccagcgcaagggcgtgcgtctg
cgcctgttccacggccgcggcggcactgtcgggcgtggcggcggtccgacctaccaggcc
atcctgtcgcagccgccgggcacggtgaacgggcagatccgcctgactgagcagggcgag
atcatctccagcaagttcgccaatccagagattggccggcgcaacctggagaccatcgtc
gcggccacgctggaagccacgctgctgccaacgcgcaaccgcccgaagggtcttgaagag
ttcgaagcagccatgcaggcgctgtcggacaacgcctttgccgcgtaccgcaacctcgtc
tacgagaccccgggcttcaaggactacttcttcgccaccacgccgatcaccgagattgcc
gacctgaacctgggttcgcgcccggcctcgcgcaagctgatggacaagaaacaccgccgc
atcgaagacctgcgtgccattccgtggggcttctcatggggccagtgccgtctgctgctg
ccgggctggttcggctttggcagcgcggtgcagcgctggctcgacgatgcgggcaacgcc
aaggcccgtgctgcgcgcctgaccacgctcaagcgcatgcacaagcagtggccgttcttt
gcgaacctgctgtcgaacatggacatggtgctgtccaaggccgacctgaacgtggcgtcg
cgctacgcccaattgtgcgacgaccgcaagctgcgcaacgcggtgttctcgcgcatctct
gcggagttcacgttgaccgagcagatgctggcagccatcacgggacagtcggagcgcctg
gccgacaacccgctgctggcgcgctccatcaagaaccgcttcccgtaccttgacccgctg
aatcacctgcaggtcgaactgctcaagcgcttccgctcgggcaaggccggcagcgacgat
gcacgcgtgcggcgcggcattcatctgtcgatcaacgggattgccgcgggccttcgcaac
agcggctga

DBGET integrated database retrieval system