KEGG   Ralstonia pickettii 12D: Rpic12D_2177Help
Entry
Rpic12D_2177      CDS       T00925                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rpf  Ralstonia pickettii 12D
Brite
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Rpic12D_2177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ACS63451
UniProt: C6BBJ5
LinkDB All DBs
Position
1:complement(2319766..2320317)
Genome map
AA seq 183 aa AA seqDB search
MKQLVIAVAAIGLMAGCASNSASTAKAANAGDGAMTASAVLAPKSGSTVQGSVKLAQQGD
NRVAMAVDISGLPANGMFGFHVHERGDCSSPDGNSAGGHFNPTSQQHGDPRQGAHHAGDI
PMLQSDANGKAVGSIVLSGVTLSPGPTSLVGHALIVHAGKDDYMTQPTGNSGGRVACGVI
VAN
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactcgtgattgcagtcgccgcgatcggcctgatggccggctgcgcatcgaac
tcagcgtcgacggccaaggcggcgaatgccggtgacggcgccatgacggcctcggccgtg
ctggcgcccaagagcggcagcaccgtgcaaggcagcgtgaagcttgcacagcaaggcgac
aatcgggttgccatggccgtggatatttccggcctgccggccaacggcatgttcggcttc
catgtgcatgagaggggcgattgctcgtcgccggatggcaatagtgccggcggccacttc
aaccccaccagccagcagcacggtgatccgcgtcaaggcgcgcatcacgctggcgacatt
ccgatgctgcaatccgatgccaacggcaaggccgtcggctcgatcgttctttccggtgtg
acgctgtcgcccgggcccaccagcctggtcggccacgcgttgatcgtccacgcaggcaag
gacgactacatgacccaaccgaccggcaattccggcgggcgcgtcgcctgcggcgtgatc
gtggcgaactga

DBGET integrated database retrieval system