KEGG   Ralstonia pickettii 12D: Rpic12D_2974Help
Entry
Rpic12D_2974      CDS       T00925                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rpf03012]
    Rpic12D_2974
   03029 Mitochondrial biogenesis [BR:rpf03029]
    Rpic12D_2974
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpf04147]
    Rpic12D_2974
Translation factors [BR:rpf03012]
 Eukaryotic Type
  Elongation factors
   Rpic12D_2974
 Prokaryotic Type
   Rpic12D_2974
Mitochondrial biogenesis [BR:rpf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Rpic12D_2974
Exosome [BR:rpf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Rpic12D_2974
  Exosomal proteins of breast cancer cells
   Rpic12D_2974
  Exosomal proteins of colorectal cancer cells
   Rpic12D_2974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACS64244
UniProt: C6BFX5
LinkDB All DBs
Position
1:complement(3130574..3131764)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLATKFGGAAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIVVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIVKGSAKLALE
GDKGELGEVAIMNLADALDTYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRIERGVVK
VGEELEIVGIKATQKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLCKPGS
IKPHTHFTGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPADKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaaagttcgagcggaccaagccgcacgtgaacgttggtacgattggtcac
gttgaccacggcaagacgacgctgaccgcggcgatcacgaccgtgctggcgaccaagttt
ggtggtgccgctaaggcatacgaccagatcgacgcggcgccggaagaaaaggcacgcggt
attacgatcaacaccgcgcacgttgagtacgaaacggccaaccgccactacgcgcacgtt
gactgcccgggccacgccgactacgtcaagaacatgatcaccggtgccgcccagatggac
ggcgccatcctggtgtgctcggccgctgacggccccatgccgcaaacgcgtgagcacatc
ctgctggcccgtcaggtcggcgtgccgtacatcgtcgtgttcctgaacaagtgcgacatg
gtggacgacgctgagctgctggagctggtcgagatggaagtgcgcgaacttctgtcgaag
tacgacttcccgggcgacgacaccccgatcgtcaagggttcggccaagctggcgctggaa
ggcgacaagggcgaactgggcgaagtggccatcatgaacctggccgacgcactggacacc
tatatcccgacgccggagcgcgctgttgacggcacgttcctgatgccggtggaagacgtg
ttctcgatctcgggtcgcggtaccgtggtgaccggccgtatcgagcgcggtgtagtcaag
gtcggcgaagagctggaaatcgtcggtatcaaagccacgcaaaagacgacctgcacgggc
gtggaaatgttccgcaagctgctggaccagggtcaagcaggcgacaacgtcggtattctg
ctgcgcggtacgaagcgcgaagacgtcgagcgcggccaagtgctgtgcaagccgggttcg
atcaagccgcacacgcacttcacgggcgaggtctacatcctgtcgaaggacgaaggcggt
cgtcacacgccgttcttcaacaactatcgcccgcagttctacttccgtacgacggacgtg
accggctcgatcgagctgccggccgacaaagaaatggtcatgccgggcgacaacgtgtcg
atcaccgtcaagctgatcgccccgatcgccatggaagaaggcttgcgcttcgcaatccgt
gaaggtggtcgtaccgtcggtgctggcgtcgtcgctaagatcatcgagtaa

DBGET integrated database retrieval system