KEGG   Ralstonia pickettii 12D: Rpic12D_4051Help
Entry
Rpic12D_4051      CDS       T00925                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00500  Starch and sucrose metabolism
rpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rpic12D_4051
Enzymes [BR:rpf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Rpic12D_4051
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Rpic12D_4051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 Mak_N_cap
Motif
Other DBs
NCBI-ProteinID: ACS65300
UniProt: C6BMJ2
LinkDB All DBs
Position
2:complement(633994..637488)
Genome map
AA seq 1164 aa AA seqDB search
MTRNPTALLVDDALWYKDAVIYQLHVKSFCDSDNDGVGDFPGLISKLDYIAELGVDVIWL
LPFYPSPRRDDGYDIAEYRGVHPDYGNMADVRRFIAEAHARGLRVITELVINHTSDQHPW
FQRARRAKPGSALRDFYVWSDNDKRYAGTRIIFIDTEPSNWTWDPVANAYYWHRFYSHQP
DLNFDNPRVLKAVIGVMKFWLNLGVDGLRLDAVPYLVEREGTSNENLPETHEVLRKIRAA
MDGEFKNRLLLAEANQWPEDTQEYFGAGDECHMAFHFPLMPRMYMAIAREDRFPITDIMR
QTPEVPAGCQWAIFLRNHDELTLEMVTDAERDYLWEVYASDRRARLNLGIRRRLAPLLER
DRRRVELMNSLLFSMPGTPVMYYGDEIGMGDNIHLGDRDGVRTPMQWSPDRNGGFSRADP
EQLVLPAIMGSLYGYESVNVEAQSRDAHSLLNWTRRLLATRKRHRVFGRGSIQFLQPSNR
KVLAYIRALEGEAPILCVANLSRASQAVELDLSTFAQRVPVELIGGTAFPPIGQLSYLLT
LPPYAFYWLELRENEPGPTWSQPAAEQLPEFTTLVLRAGLDALADTRQREAHRQLIEREI
LPTYLPKRRWFAAKDSVLRSAKFAWGAPVPVDAASTNRPLAGATRPEVFLNEVAVTLGSP
DGTERVERYLLPLSIAWESATLPALPIQLALARVRRGRHVGYLTDAFTTETFARALLTNL
VRGTTLEANDGTVHFEPEPNIAELAEPAGAPEAGSTRPAPLPLAPDTPIQWLAAEQSNSS
LVIGESVIVKLIRRIATGIHPEVEMTRHLTRVGYANTAALIGEVSHHAADGERATLAVMQ
SFVPNQGDAWTWALDYLRRTIDELAVQMEGVTTGDGESSPVAVSEARVDTDEALAGYVNF
IGVIGTRLGELHAALAAPTEDPNFGARIADADDATYWIARVSEQLTRAHDNLTAWQRQNP
DSARQPDVQWLLSQHQALLDAARAHAENGLGATLSRIHGDFHLGQVLVAQGDAFLIDFEG
EPSRPVEERRRKTSPLRDVAGLMRSLDYVVGAMRQGPDHVAGPAQERRNVLLERFRAAST
ERFLEAYAAAIRGPDLNALDQPVVDFHLLDLFLLEKAAYEVNYEASNRPTWLPIPLEGFT
RVARRLLHAEPPSPAAEDPTGGPP
NT seq 3495 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcaatccgaccgcgctgctggtggacgacgcgctctggtacaaggacgccgtc
atctatcagctgcatgtcaaatcgttctgcgattccgacaacgacggcgtcggggacttc
cccgggttgatctccaagctcgactacattgccgagctgggggtggacgtcatctggctg
ctcccgttctatccgtcaccgcgccgcgacgacggctacgacatcgctgaataccgcggc
gtccaccccgattacggcaacatggccgacgtgcgccgcttcattgccgaagcgcatgcg
cggggcctgcgcgtgatcacggaactggtcatcaaccacacgtccgatcagcacccgtgg
ttccagcgtgcgcggcgcgccaagccgggctctgcgctgcgcgacttctacgtgtggtcc
gacaacgacaagaggtacgccggcacgcgcatcatcttcatcgataccgagccttcaaac
tggacgtgggacccggtggccaacgcctattactggcaccgcttctactcgcaccagccc
gatctcaacttcgacaacccgcgcgtgctcaaggcagtgatcggcgtgatgaagttctgg
ctcaatctgggcgtggatggtctgcggctcgatgccgtgccgtatctcgtggaacgcgaa
ggcacgtcgaacgagaacctgcccgagacacacgaagtgctgcgcaagattcgcgcggcc
atggatggggaattcaagaaccgcctgctgctggccgaggccaaccagtggccggaagac
acgcaggaatacttcggtgccggcgacgaatgccacatggcgttccactttccgctgatg
ccgcgcatgtacatggcgatcgcgcgtgaagaccgttttccgatcaccgacatcatgcgc
cagacgccggaggtgcccgccggctgccaatgggccatcttcctgcgcaatcacgacgaa
ttgacgctcgaaatggtgaccgatgccgagcgcgactacctctgggaggtctacgcaagc
gaccgccgcgcgcgcctgaacctgggcatccgccgccggctggcaccgctgctggaacgc
gaccgccgccgcgtcgagctgatgaacagcctgctcttctccatgcccggcacgcccgtc
atgtattacggcgacgaaatcggcatgggcgacaacatccacctcggcgaccgcgacggc
gtgcgcacgccaatgcagtggtcccccgaccgcaacggcggcttctcgcgcgccgacccc
gaacagctcgtgctgccggccatcatgggctcgctgtacggctatgaatcggtgaacgtg
gaagcgcagagccgcgacgcgcattcgctgctgaactggacgcgccggctgcttgccacg
cgcaagcggcatcgcgtgttcggccggggttccatccagtttctgcagccgtccaaccgc
aaggtgctggcgtatatccgcgcgctcgaaggcgaagcgccgatcctgtgcgtggcgaac
ctctcccgcgcctcgcaggctgtggagctggatttgtccacctttgcgcagcgggtgccg
gtggagctgattggcgggacggcgtttccgcccatcggccagttgtcgtatctgctcacg
ctgccgccctacgccttctattggctggagctgcgcgagaacgagcctggcccgacctgg
tcgcaaccggctgccgagcaattgcccgagttcacgacgctggtgctgcgcgcagggctg
gatgccctggccgatacgcgacagcgcgaggcacaccgccagttgatcgaacgcgaaatc
ctgccaacctatctgcccaagcgccgctggtttgccgccaaggacagtgtgctgcgtagc
gcaaagtttgcctggggcgcccccgtgccggtggatgccgcatccaccaaccgcccgctg
gccggggcaacgcggcccgaggtgttcctcaacgaagtggccgtcacgctgggcagcccc
gacggcaccgagcgcgtcgagcgctacctgctgccgctttccatcgcatgggaatcggcc
acgctgccggctctgcccattcagctcgccctggcgcgcgtgcggcgcggccgccatgtc
ggctacctgactgacgccttcaccaccgagaccttcgcccgggcgctgctcaccaacctc
gtgcgcggcaccacgctggaagccaatgacggcaccgtgcatttcgagcctgaaccgaac
atcgcagagctggccgaacctgccggggcgcctgaagccggcagcacacggcctgcgccg
ctgccgctggcacccgacacgcccatccagtggctggcggccgagcaatcgaacagctcg
ctggtgattggcgagtccgttatcgtcaagctgatccgccgtatcgcaacgggcatccac
cccgaggtggagatgacgcgacacctcacgcgcgtgggctacgccaacacggcggcactc
atcggcgaagtctctcaccacgctgccgacggcgaacgcgccacgctggccgtcatgcag
agcttcgttcccaaccagggcgatgcctggacgtgggcactggactacctgcgacgcacc
atcgacgaactggccgtgcagatggaaggcgtgaccacgggcgatggtgaatcgtctccg
gtggcggtctcggaagcgcgcgtggataccgacgaggcgttggccggctacgtcaacttc
atcggcgtgatcggcacgcggctgggcgaattgcatgccgcgctggcggcgcccaccgaa
gacccgaacttcggcgcgcgcattgcagatgccgacgatgccacctactggatcgcccgc
gtgagcgagcagctgacccgcgcgcatgacaacctgacggcatggcaacggcaaaatccc
gacagcgcacggcaacccgacgtgcaatggctgctgtcgcaacaccaggcgctgctcgac
gccgcccgcgcgcatgccgaaaacggcctgggcgcaacgctctcgcgcatccatggcgat
tttcacctcggccaggtgctggtggcgcagggcgatgccttcctgatcgactttgaaggc
gagccctcccgccccgtggaagaacgccggcgcaagaccagcccgctgcgcgacgtggcg
gggctgatgcgctcgctcgactacgtggtgggcgccatgcgtcagggccccgatcatgtg
gccgggcccgcgcaggagcgccgcaacgtcctgctggagcggttccgcgctgcgtccacc
gaacgcttcctggaggcgtatgccgctgccattcgcgggcccgatctgaacgcgctggat
cagcccgtggtcgactttcacctgctcgatcttttcctgctggaaaaggccgcatacgaa
gtcaactacgaagcgtccaaccgcccgacctggctgccgattccgctggaaggcttcaca
cgcgtggcacgccgcctgctgcatgcagagccaccatcacccgctgcagaagacccgacg
ggaggcccaccgtga

DBGET integrated database retrieval system