KEGG   Rickettsia prowazekii GvV257: MA5_03135Help
Entry
MA5_03135         CDS       T01791                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rpg  Rickettsia prowazekii GvV257
Pathway
rpg00061  Fatty acid biosynthesis
rpg00780  Biotin metabolism
rpg01100  Metabolic pathways
rpg01130  Biosynthesis of antibiotics
rpg01212  Fatty acid metabolism
Module
rpg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rpg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MA5_03135
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    MA5_03135
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    MA5_03135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rpg01004]
    MA5_03135
Enzymes [BR:rpg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     MA5_03135
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     MA5_03135
Lipid biosynthesis proteins [BR:rpg01004]
 Fatty acid synthase
  Component type
   MA5_03135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AFE52803
LinkDB All DBs
Position
complement(785231..786016)
Genome map
AA seq 261 aa AA seqDB search
MTTGLLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSEVLEKRVKPLAEEIGCN
FISELDVTNQKSISNLFNDIKEKWNSFDFLLHGMAFANKNELKGRYVETSLENFHNSLHI
SCYSLLELSRSAETLMHNGGSIVTLTYYGAEKVIPNYNIMGVAKAALEASVKYLANDMGE
NNIRVNAISAGPIKTLASSAISDFSTMLKSHAATAPLKRNITQEDVGGAAVYLFSELSKG
VTGEIHYVDCGYNIIGSSKLL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgactacaggattactacaaggaaaaaaaggtttaattacaggtattgcaaataatatg
tcaatatcgtgggcgattgcacagcttgctaaaaaacacggagcagaattatggtttact
tatcaatcagaagtactcgaaaaacgtgttaaaccacttgctgaggaaataggttgtaat
tttattagtgaacttgatgtgacgaatcaaaaatcaattagtaatttatttaatgatata
aaagagaaatggaatagttttgatttcttactccatggtatggcttttgctaataaaaat
gaattaaaaggacgttatgtagaaacaagcttagaaaattttcataattctttacatata
tcatgttactcgcttttagaactctcaagatccgcagaaacattaatgcataacggtggg
agtattgtcacattaacgtactacggtgctgaaaaagttatacctaattataacattatg
ggagtagccaaagctgcacttgaggctagtgtaaaatatctagcaaacgatatgggagaa
aataatattagagtaaatgctatttcggcaggccctatcaaaactttagcatctagtgca
ataagcgattttagtactatgcttaaatctcatgctgcaactgcaccgttaaaacgtaat
attactcaagaagatgtaggaggagcagctgtatatttatttagtgaattatctaaaggt
gttacaggagaaattcattatgtagattgcggttataatattataggaagtagtaaatta
ttgtag

DBGET integrated database retrieval system