KEGG   Rickettsia philipii: RSA_06845Help
Entry
RSA_06845         CDS       T01759                                 

Definition
(GenBank) multimodular transpeptidase-transglycosylase PBP 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
rph  Rickettsia philipii
Pathway
rph00550  Peptidoglycan biosynthesis
rph01100  Metabolic pathways
rph01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rph00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RSA_06845
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    RSA_06845
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rph01003]
    RSA_06845
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rph01011]
    RSA_06845
Enzymes [BR:rph01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     RSA_06845
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     RSA_06845
Glycosyltransferases [BR:rph01003]
 Polysaccharide
  Bacterial polysaccharide
   RSA_06845
Peptidoglycan biosynthesis and degradation proteins [BR:rph01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   RSA_06845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AFB26841
UniProt: H6PVE4
LinkDB All DBs
Position
complement(1171505..1173877)
Genome map
AA seq 790 aa AA seqDB search
MYKSLLFCLKIFVFLILVGCGITAYIIYHYSRDLPDYSQLARYYPPSVTRIYSRDGKLME
EYAFERRVFVPINSVPSSLIESFIAAEDKNFYNHPGVDLFGIVRAAFLNISNYLHNRRME
GASTITQQVVKNFLLTNEVSLERKIKEAILSYMISRVFTKDQILELYLNQTFFGRGAYGV
AVAAQNYFNKSVEELTIAESAFIAALPKAPSELNPERNYARVKARRDYVIARMFEDGYIT
RDAAKEAMDSPIVLRKRAKEETVTADYYAAQVREEVIRMLNSQEEFYTGGLTIITSLDAK
MQQLAENSLRKGLREFDRRRGFRKPIANISLDNWQGELKKLPTPPSLLEYKLAVVLDVAD
NHVEIGLIDGSKSKMPIAEMKWARSNLKSVKTLLKKGDVIVVEAIKEGYALRQIPEINGA
IMVMNPNTGQVLASVGGYDFSTSKFDRVTQALRQPGSLSKTFVYLAALENGVKPNQIFND
GPIEISQGPGMPSWRPKNYEGKFLGEITMRTGLEKSRNLITVRVATAVGLTKIVDIIKRF
GINNEPKKVYSMVLGSIETTLSRMTNAYAIIANGGKKVEPHFVELIKDRNGKIIYRRDDR
ECLACNVSDSNLDTAILEIPKEYIYRVTDEASDYQITSFLTGAIDRGTGYAAKKLGKIIG
GKTGTSNNSKDTWFVGFTPTIVVGSYVGYDTPKELGKRATGSNVVLPIFIDFMSNAYKDK
PSLPFKVPDSIKLIAVDRATGKITPSGTVIEAFKVNNVQMLENEYMIDNQDNNDIFDYVP
SKEDQSQEIY
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgtataaatctcttcttttttgtttaaaaatttttgtcttccttattttagtaggttgc
gggattactgcttatataatataccactattcacgtgatttgcctgattactcacagctt
gcacgttattatccgccgtcggtaacgcgtatttattcccgtgacggcaaattaatggag
gagtacgcttttgaacgtcgtgtgtttgtaccgattaatagcgtaccgagttcgctaata
gaaagttttattgcagctgaggataagaatttctataaccatcccggcgttgatttgttt
ggaatagttagagcggcatttttaaacatatctaattatttacataataggcgtatggaa
ggagcgtctaccattactcagcaagtggttaaaaattttctgctaactaacgaagtttct
cttgaacgtaagattaaagaagcgattctttcttatatgatttcaagagtatttactaag
gatcaaattttagaattatatcttaatcaaacattttttggtcgtggtgcatacggtgtt
gcggtagctgcacaaaattattttaataaatccgtagaggaacttactattgcagaatca
gcttttattgcggcactgcctaaagccccttccgaacttaatcctgagagaaactatgct
agagtaaaagctcgtcgtgattacgtaatagcacgtatgtttgaagatggttatataaca
agagatgctgcgaaagaagctatggatagcccgatagttttacgtaaacgagctaaggaa
gaaactgttacggcagattattatgctgcacaggtcagagaagaagtaattaggatgtta
aatagtcaggaagaattttataccggaggtcttactatcattacttctttagatgcaaag
atgcagcaattagctgaaaactctctaagaaaaggtctaagggagtttgatagaaggcgt
ggttttagaaagcctatagctaatatttctcttgataattggcaaggagagctaaaaaaa
ctaccaactcctccatcgcttttagagtataaattagctgtagttctagatgtagccgat
aatcatgtagagattggacttatagacggcagtaaatctaagatgcctattgctgaaatg
aaatgggcaagaagtaatcttaaatcagttaagaccttgcttaaaaaaggtgatgtgata
gtggttgaggctataaaagaggggtatgctcttcgtcagattcctgaaataaacggtgct
attatggttatgaacccaaataccggacaggtacttgcaagcgttggcggttatgatttt
tccacaagtaaatttgatagagtaactcaagcactgcgtcaacccggttctttgagtaaa
acctttgtttatttagcagctcttgaaaacggtgttaagccgaatcagatttttaatgat
ggacctattgagatttcgcaaggtccagggatgcctagttggcgtcctaaaaattatgag
ggtaagtttttaggtgaaatcactatgcgtactggtcttgaaaaatctcgtaatcttata
accgtaagagttgcaactgccgtaggacttacaaaaatcgttgatataattaagcgtttc
ggtattaataatgaaccaaaaaaagtttactctatggtacttggttcaattgaaaccaca
cttagcagaatgactaatgcttatgcaattattgctaacggcggtaaaaaagttgagcct
cattttgtagaattaattaaagatcgtaacggtaaaattatttataggcgagatgataga
gaatgtcttgcttgtaatgtttcggatagtaatttagataccgcaatattagaaataccg
aaagaatatatctatagagttacggatgaagctagtgattatcaaattacttcgttttta
accggagcaatagatagaggtaccggttatgctgcgaagaagttagggaaaattatcggc
ggaaaaactggtactagtaacaatagtaaagatacatggtttgtaggttttacacccaca
atagtagtcggcagttatgtgggttatgatacaccgaaagagcttggaaaaagagcaaca
ggctcaaacgtagtattaccgatttttattgattttatgagtaatgcttataaggataag
ccatcgctgcctttcaaagttccagattcaattaagctaattgccgtagatagagcaact
ggtaaaattacaccaagcggtactgttatagaagcatttaaagtaaataatgttcagatg
cttgagaatgaatatatgattgataatcaagataataatgatatttttgattatgtaccg
agtaaggaagatcaatcgcaggaaatttactaa

DBGET integrated database retrieval system