KEGG   Rhizobium phaseoli: AMC79_CH00099Help
Entry
AMC79_CH00099     CDS       T04590                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rpha  Rhizobium phaseoli
Pathway
rpha00250  Alanine, aspartate and glutamate metabolism
rpha00410  beta-Alanine metabolism
rpha00640  Propanoate metabolism
rpha00650  Butanoate metabolism
rpha01100  Metabolic pathways
rpha01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AMC79_CH00099 (gabT)
   00650 Butanoate metabolism
    AMC79_CH00099 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMC79_CH00099 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMC79_CH00099 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rpha01007]
    AMC79_CH00099 (gabT)
Enzymes [BR:rpha01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AMC79_CH00099 (gabT)
Amino acid related enzymes [BR:rpha01007]
 Aminotransferase (transaminase)
  Class III
   AMC79_CH00099 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ANL95953
UniProt: A0A2U3D4C1
LinkDB All DBs
Position
complement(107414..108694)
Genome map
AA seq 426 aa AA seqDB search
MTATSLTDRKNAAISRGVGMTTQIYADRAENAEIWDKEGRRYIDFAAGIAVLNTGHRHPK
VIAAVKDQLDHFTHTCHQVVPYESYVSLAERLNALLPGDFEKKTIFVTTGAEAVENAVKI
ARAATGRSAVIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVFHVPFPVELHGVTAD
QSLAALKKLFATDVDPQRVAAIIIEPVQGEGGFYPAPAAFMKALRELCDQHGILLIADEV
QTGFARTGRMFAMDHHEVAADLTTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGN
PLGIAAAHAVLDVIKEEDLCDRANQLGSRLKQRLESLRETVPEIADIRGPGFMNAVEFND
RKTGLPSAEFANRVRLIALDKGLILLTCGVHGNVIRFLAPITIQDEVLGEALDILEASML
EASAAK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgacaagccttacggaccggaagaacgccgcgatttcgcgcggcgtcggcatg
accacccagatctatgcggaccgggcagagaatgccgaaatctgggataaagaaggccgc
cgctatatcgatttcgccgccggcattgccgttctcaacaccggccaccgtcaccccaaa
gtcatcgcggcagtcaaggatcagctcgaccatttcacccatacctgccaccaggttgtt
ccctacgaaagctatgtcagccttgccgaacggttgaacgcgctgctgccgggtgacttc
gagaagaagacgatcttcgtcacgacgggcgctgaggcggtggaaaatgccgtcaagatc
gcgcgtgcggccaccggccgctcggccgtcatcgccttcggcggcggctttcacggccgc
accttcatgggcatggcgctgaccggcaaggtggtgccctacaaggtcggcttcggcgcg
atgccgggcgacgtgttccacgttcccttcccggtcgagctgcatggcgtcaccgccgat
cagtcgctggcggcgctgaagaagctttttgccactgatgtcgatccgcagcgggtcgcc
gccatcatcatcgagccggtgcagggcgaaggcggcttctacccggcgccggccgccttc
atgaaggcgctgcgcgaactctgcgaccagcacggcatcctgctgatcgccgacgaggtg
cagaccggttttgcccgcaccggccggatgttcgcgatggatcatcacgaggtggcggcc
gacctgacaacgatggcaaagagccttgccggcggctttccgctcgccgcggtcaccggc
cgcgccgagatcatggacgcgcccggaccgggcggtctcggcggcacatatggcggcaat
ccgctcggcatcgccgctgcgcatgccgtcctcgacgtcatcaaggaggaggatctctgc
gatcgtgccaaccagctcggcagtcggctgaaacaacggctggaatcgctgcgcgagacg
gtgccggagatcgccgacatccgcgggccgggcttcatgaatgcggtcgaattcaacgac
cggaagaccggtttgccgagcgccgaattcgccaaccgggtgcggctgatcgcgctcgac
aagggcttgatcctgctcacctgcggcgtccacggcaatgtcatccgctttctcgcgccg
atcaccatccaggacgaggttctcggcgaggcgctcgacatactcgaggcctcgatgctg
gaagccagcgcggccaagtaa

DBGET integrated database retrieval system