KEGG   Rhizobium phaseoli: AMC79_CH02116Help
Entry
AMC79_CH02116     CDS       T04590                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rpha  Rhizobium phaseoli
Pathway
rpha00010  Glycolysis / Gluconeogenesis
rpha00020  Citrate cycle (TCA cycle)
rpha00620  Pyruvate metabolism
rpha01100  Metabolic pathways
rpha01110  Biosynthesis of secondary metabolites
rpha01120  Microbial metabolism in diverse environments
rpha01130  Biosynthesis of antibiotics
rpha01200  Carbon metabolism
Module
rpha_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMC79_CH02116 (pdhC)
   00020 Citrate cycle (TCA cycle)
    AMC79_CH02116 (pdhC)
   00620 Pyruvate metabolism
    AMC79_CH02116 (pdhC)
Enzymes [BR:rpha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AMC79_CH02116 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 QRPTase_N DUF2118 HlyD_2 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: ANL97904
LinkDB All DBs
Position
2126182..2127522
Genome map
AA seq 446 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKLV
VAAGTEGVKVNALIAVLAADGEDVAAAASGAGSAAPVKADAAPAARAEAASAPSAPAPAA
APATASSNGNRTFSSPLARRLAKEAGIDLSAVAGSGPHGRVVKSDVEAAVAGGGAKAAPA
PAAAAPQAAAAAAPAAAAPKGASEEAVLKLFEPGSYELVPHDGMRKTIARRLVESKQTIP
HFYVSVDCELDALMALRAQLNDAAPRKDNAPAYKLSVNDMVIKAMALALRDVPDANVSWT
DSNMVKHKHADVGVAVSIPGGLITPIIRKAEQKTLSVISNEMRDLGKRAKDRKLKPEEYQ
GGTSSVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVVVKNGEMAIATVMSVTLSTDHR
CVDGALGAELLQAFKGYIENPMGMLV
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatatcacgatgcccgccctctctccgaccatggaagaaggcaatctggcc
aagtggctggtcaaggaaggcgacaaggtcaagtctggcgatgtgatcgccgagatcgag
accgacaaggcgacgatggaagtcgaagccgtcgatgaaggaacggtcgccaagctcgtc
gttgccgccggcaccgaaggcgtcaaggtcaatgcgctgatcgccgttctcgccgccgat
ggcgaagatgtcgccgctgccgcaagcggcgccggttcggccgctcctgtgaaggctgat
gccgccccggctgccagggccgaggctgcttcggccccgtctgcaccggcgcctgccgct
gcccctgccacggcttcatcaaacggcaaccgcaccttctcttcgccgctcgcccgcagg
cttgccaaggaggccggcatcgacctttcggcggtcgcaggctccggcccgcatggccgc
gtcgtcaagagcgacgtcgaagccgccgtcgccggcggtggcgccaaggcagcgcccgca
ccggccgctgctgctccgcaggccgccgcagctgccgctccggccgccgcagcgccgaag
ggcgcttctgaggaagccgtgctcaagctgttcgagccgggctcatacgagctcgtgccg
catgacggcatgcgcaagacgatcgcccggcgcctggtcgaatccaagcagacgatcccg
catttctacgtcagcgtcgattgcgagctcgacgcgctgatggcgctgcgcgcccagctg
aacgatgcggcgccgcgcaaggacaacgctccggcctacaagctttcggtcaacgatatg
gtcatcaaggccatggcgctggcactgcgcgatgttccggatgccaacgtgtcgtggacc
gacagcaacatggtcaagcacaagcacgccgatgtcggcgtcgccgtctcgatccccggc
ggcctgatcacgccgatcatccgcaaggccgagcagaagacgctgtctgtcatttccaat
gagatgcgcgatctcggcaagcgggccaaggaccgcaagctgaagcccgaggaatatcag
ggcggcaccagctcggtctccaacatgggcatgatgggcgtcaagaacttcgccgccgtc
gtcaacccgccgcatgcgacgatcctcgcagtcggcgccggcgagcagcgggtcgtcgtc
aagaacggcgaaatggcgatcgccacggtgatgtcagtcacgctctcgaccgaccatcgc
tgcgtcgacggcgcgctcggcgccgagctgctccaggccttcaagggctacatcgagaac
ccgatgggcatgcttgtctga

DBGET integrated database retrieval system