KEGG   Rhizobium phaseoli: AMC79_CH02617Help
Entry
AMC79_CH02617     CDS       T04590                                 

Definition
(GenBank) TauE/SafE family permease protein
  KO
K07090  uncharacterized protein
Organism
rpha  Rhizobium phaseoli
Brite
KEGG Orthology (KO) [BR:rpha00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    AMC79_CH02617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE MscL
Motif
Other DBs
NCBI-ProteinID: ANL98396
LinkDB All DBs
Position
2647682..2648467
Genome map
AA seq 261 aa AA seqDB search
MPDIAFHLLLLLCAAAFFAGFVDAIAGGGGLITVPAMLIAGIPPLQTLGTNKVQSIFGAA
SATLAYARKGHVQLHEQLPMALMAVMGGAIGAALATIVPGQVLQAIMPVLLLAIAIFFAV
KPNLNDLDKHRIITPFVFGLTLVPAIGFYDGVFGPGTGSFFMLAFITLAGFGVLKATAHT
KLLNFGSNLGALIVFASFGAILWKIGLLMGICQFLGAQLGSRLAMRIGAKLIKPLLVIVC
VALAVKLLANPANPLRVWLGV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgacatcgccttccatctgcttctgctgctctgcgccgctgccttctttgccggt
ttcgtcgatgccatcgccggcggcggcggcttgatcaccgtccccgccatgctgatcgcc
ggcattccgccgctccagacactcggcaccaacaaggtgcagtcgatcttcggcgccgct
tcggcaacactcgcctatgcccgcaaaggccatgtgcagctgcacgaacagctgccgatg
gcgctgatggccgtgatgggcggggcgatcggcgctgcccttgccacgatcgtgcccgga
caggtgctacaggcgatcatgccggtgctgctgctggcgatcgcgatcttctttgccgtc
aagccgaacctcaacgatctcgacaaacaccggatcatcacgcctttcgtcttcggcctg
accttggtaccggccatcggcttttatgacggcgtcttcggtccgggcaccggttccttc
ttcatgctcgccttcatcaccctcgccggcttcggcgtgctgaaggccaccgcccatacc
aagcttctcaatttcggctcgaatctcggcgcactgatcgtcttcgcaagcttcggcgcg
atcctctggaaaatcggcctgctgatgggcatctgccagttcctcggcgctcagctcggc
tcacggctcgccatgcgcatcggcgccaagctcatcaagccgctgctcgtcatcgtctgc
gtcgctctcgcggtaaagctgcttgccaatcccgcgaacccgctgcgcgtctggctcggc
gtctaa

DBGET integrated database retrieval system