KEGG   Rhizobium phaseoli: AMC79_CH03132Help
Entry
AMC79_CH03132     CDS       T04590                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase GroES-like protein
Organism
rpha  Rhizobium phaseoli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ANL98901
LinkDB All DBs
Position
3169350..3170378
Genome map
AA seq 342 aa AA seqDB search
MKAIRLQATGQLQLCEVEKPAPGPGDLLVRVEACGICGTDRHIFHGEFPSKPPVTLGHEF
AGVVEAVGAGVTDFRPGMRVTGDPNISCGGCEECRRGRVNLCRKLQAIGIHRDGGFAEYV
CMPESQAFALPTDIDPLHGAFCEPLACCIHGVDLAGLRAGSSAVVLGGGVIGLLTIQLAR
LAGATRIVLVTRSAEKRRLAESLGATATADPGDGDIIARIIAEDGLLPGGADVVFECAGV
AETMQQAPRLARRGGTAVILGVMPQGATIEIEPFDLLFREVALISSFVNPFTHARAADLI
ASGRIKVGPLISRRIGLEEAPEAITNPARGGEIRVLVVPDGK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatacgcctgcaagcgacaggacagttgcagctttgcgaggtcgaaaaacca
gcaccagggccgggcgacctgctggtccgcgtcgaagcctgcggcatttgcggcaccgac
cgccatatcttccatggcgaatttccctcgaagccgccggtgacgctcggccatgaattt
gcaggcgtcgtcgaggcggttggagccggcgttaccgatttccgccccggcatgcgcgtg
acgggcgatcccaacatctcttgcggcggctgcgaggaatgccggcgcggccgcgtcaat
ctctgccggaagctgcaggcgatcggcattcaccgcgacggcggcttcgccgaatatgtc
tgcatgcctgaaagccaggcttttgccctgccgacagatatcgacccgctgcacggcgcc
ttctgcgagccgctggcctgctgcatccacggcgtcgatctcgccgggttaagggctggc
tcgtcggccgtcgtgctcggcggcggcgtcatcggcctgctcacgattcagctggcacgg
cttgccggcgctacccgcatcgtgctggtgactcgcagcgccgaaaagcgccggctggcc
gaaagcctcggcgcgacggcaacggccgatcccggtgacggcgatatcattgctcgtatc
atcgccgaagacgggcttctgcccggcggcgccgacgtcgtcttcgaatgcgccggtgtg
gccgagacgatgcagcaggcgccccggcttgcccgtcgcggcggcaccgccgtcattttg
ggggtcatgccgcagggcgccacgatcgagatcgaacccttcgacctgctgtttcgcgaa
gtcgcgctgattagctccttcgtcaatcctttcacccatgcccgcgccgccgatctcatc
gcctccggcaggatcaaggtcgggccgctgatatccaggcggatcgggcttgaggaggcc
ccggaagcgatcaccaacccggcccgcggaggcgaaatccgggtgctcgtcgtgccggac
gggaaatag

DBGET integrated database retrieval system