KEGG   Rhizobium phaseoli: AMC79_CH03244Help
Entry
AMC79_CH03244     CDS       T04590                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rpha  Rhizobium phaseoli
Pathway
rpha00240  Pyrimidine metabolism
rpha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpha00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AMC79_CH03244 (tdk)
Enzymes [BR:rpha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AMC79_CH03244 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: ANL99007
UniProt: A0A192TDR6
LinkDB All DBs
Position
complement(3285346..3285948)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFNYSTMNAGKSTLLLQASYNYQERGMRTVQLIAAFDERAGRGVIGSRIGLEASAI
PFEPHEDLFNLIAGLCGDGAPISCVFVDEAHFMTAVHVWQLARVVDRLGIPVMVYGLRTD
FQGKLFPASQELLAIADEMREVRTICHCGRKATMVVRLDAQGKVLHEGAQIDVGGNEKYV
SLCRRHWDDEMNGAWIAEPV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttcaactattcgacaatgaacgccggcaagtcgacgctgctgctg
caggcctcctataattatcaagagcgcggcatgcgtacggtgcagttgatcgccgccttc
gacgagcgcgccggccggggcgtgatcggctcgaggatcgggctggaagcgagcgctatt
cccttcgagccgcatgaagatctgttcaatctcatcgccggtctgtgcggcgacggggcg
ccgatttcctgcgtcttcgttgatgaggcgcatttcatgacggccgtccatgtctggcag
ctggcccgtgtcgtcgatcggctcggcatccctgttatggtctatgggctccggaccgac
ttccagggcaaactgtttccggcctcgcaggagctgctggcgatcgccgacgagatgcgc
gaagtgcgcacaatctgccattgcggccgtaaggcgacgatggtggtgcggctcgacgcc
caaggcaaggtgctgcacgagggggcgcagatcgatgtcggcggcaacgagaaatatgtt
tcgctctgccgcaggcactgggacgacgaaatgaacggggcctggatcgccgagccggtc
tga

DBGET integrated database retrieval system