KEGG   Rhizobium phaseoli: AMC79_PD00355Help
Entry
AMC79_PD00355     CDS       T04590                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rpha  Rhizobium phaseoli
Pathway
rpha00564  Glycerophospholipid metabolism
rpha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpha00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AMC79_PD00355 (glpD)
Enzymes [BR:rpha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AMC79_PD00355 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 Pyr_redox_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ANM01524
LinkDB All DBs
Position
pRphaN261d:complement(377618..379132)
Genome map
AA seq 504 aa AA seqDB search
MGREIYDIFVIGGGINGCGIARDAVGRGYSVALAEMNDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMEREILWAMAPHIIWPLRFVLPYHKGGIRPAWLIRLGLFLYDHLGGRKLL
PATSVLDMRKDPAGKPLKALFTRAFEYSDGWVDDARMVVLNARDAADKGAAIMPRTKVVS
ARRENGLWHIETVDAVTGRNDSHQARMLVNAAGPWVDHVIRSAFGQNEAHHVRLVQGSHI
IVKKKFDDPRAYFFQNPDNRIIFAIPYEGDFTLIGTTDRDYTADPRDVRISEEETVYLCN
AASEYFKEPVRPEDIVWTYSAVRPLYDDGASKAQEATRDYVLKLEGEGQTAPLLNVFGGK
LTTYRRLSEHALEKIGAAIGVKGAPWTAKSHLPGGDFPVRGYEGQVAALKRRYPFLADQH
ARRLVRRYGTRAETLLGNARGTNDLGRLFGGDLYEAEVAYLVEHEWARHAEDVLWRRTKD
GLRLSKEQAQSLEEYMAAMPAMAG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
ttgggccgggagatatacgatattttcgtcattggcggcggcatcaacggctgcggcatc
gcgcgtgatgccgtcgggcgcggctattccgtcgcgctggcggagatgaacgatttcgcc
tccggcacctcatccggcgccaccaagctgattcatggcggcctgcgttatctcgagcat
tacgagttccgcctggtccgtgaatcgttgatggagcgcgagatcctctgggcgatggcg
ccgcacatcatctggccgctgcgtttcgtattgccttatcataagggcggcattcgcccc
gcctggctgatccggctcggcctcttcctctacgaccatctcggcggccgcaagctgctg
ccggcgacctcggtgctcgacatgcgcaaggacccggccggcaagccgctgaaggcgcta
tttacgagagcgttcgaatattccgacggctgggtcgatgacgcccgcatggtggtgctg
aacgcccgtgatgccgccgacaagggtgcggccatcatgccgcgcaccaaagtggtctcg
gcaaggcgcgagaacggcctgtggcatatcgagaccgtcgatgcggtcaccggccgcaat
gacagtcatcaggcccgtatgctggttaacgccgctggcccgtgggtcgatcatgtcatt
cgttccgccttcggccagaacgaggcccaccatgtccgcctcgtccagggcagccatatt
atcgtgaagaagaagttcgacgatccgcgcgcctatttcttccagaatccggacaatcgc
atcatcttcgccattccctatgagggcgacttcaccctgatcggcacgaccgaccgcgat
tacaccgccgatccgagggatgtccggatctccgaggaggagacggtctatctctgcaat
gcggcgtccgaatatttcaaggagccggtgcggccggaagatatcgtctggacctattcg
gcggtccgcccgctttatgacgacggtgcctcgaaggcgcaggaggcgacgcgcgactat
gtgctgaagctggaaggcgaggggcagaccgcgccgctgctcaatgttttcggtggcaag
ctcaccacctatcgccgcctgtccgagcacgcgctggagaagatcggtgctgcgatcggc
gtcaagggtgctccctggacggccaagagccatctgcccggcggcgatttcccggtccgc
ggttatgaggggcaggtcgctgcgctgaagcggcgctatccgttcctcgccgatcagcac
gctcgccggctggtccgtcgctacggcaccagggccgagacgctgctcggcaatgcccgc
ggcaccaacgatcttggacggttgttcggcggcgatctctacgaggccgaggtcgcctat
ctggtcgaacatgaatgggcccggcacgccgaagacgtgctgtggaggagaacaaaggat
ggtctgcgcctttcgaaggagcaggctcagtcactggaggagtacatggctgccatgccg
gcgatggccggatag

DBGET integrated database retrieval system