KEGG   Rhizobium phaseoli: AMC79_PD00569Help
Entry
AMC79_PD00569     CDS       T04590                                 

Gene name
argE
Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
rpha  Rhizobium phaseoli
Pathway
rpha00220  Arginine biosynthesis
rpha01100  Metabolic pathways
rpha01110  Biosynthesis of secondary metabolites
rpha01130  Biosynthesis of antibiotics
rpha01210  2-Oxocarboxylic acid metabolism
rpha01230  Biosynthesis of amino acids
Module
rpha_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:rpha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AMC79_PD00569 (argE)
Enzymes [BR:rpha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     AMC79_PD00569 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ANM01737
LinkDB All DBs
Position
pRphaN261d:610937..612061
Genome map
AA seq 374 aa AA seqDB search
MQAIEILERLVGFPSVVGTPNGEIVAWIRHYLKSHGIAATELPGPEGDRSNLFATIGPVE
APGYILSGHMDVVPAAEAGWSSDPFRLRAEADRLYGRGSTDMKGFLAAVLAAVPALAATR
LRRPIHLAFSYDEEAGCRGVPHMIARLPELSARPLGAIIGEPSNMRAIRAHKGKAAARLT
VRGRSGHSSRPDQGLNAIHAMTGVLACANAEAARLTHGPFEDVFEPPYSSLQVGTLKGGQ
AVNIIPDTCEAEFEARAISGVDPAVLLAPLRAAAEALPPLGFKVEWRELSAYPALSLAAD
APLARLLGELTGIEPLAAVSYGTEAGLFQRAGIDAIICGPGDIGRAHRPDEFIHVSELLA
CQAMVEALARRCTA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcaattgaaattctcgaaaggctcgtcggctttccctccgtcgtcggtacgccg
aacggcgaaatcgtcgcctggatccgccactatctcaaaagtcacggtattgccgccacc
gagcttcccggccccgagggtgaccggtcgaacctcttcgcgacgatcgggccggtcgaa
gcgccgggttatatcctctccggccatatggatgtggtccctgccgccgaggccggctgg
agcagcgacccgttccgcctgcgggctgaagcggatcgcctttacggccgcggcagcacc
gacatgaagggcttcctagcagccgttcttgccgccgtgccggcgctcgcagcaacgcgg
ctccgccggcccattcatcttgccttttcctacgatgaggaggccggctgccgcggcgtc
ccgcacatgatcgcacgcctgccggaactcagtgcccgcccgcttggcgcgatcatcggc
gagccgagcaacatgcgggcaatccgcgcccacaagggcaaggccgccgcccggctgacg
gtcaggggccggtccggccattcctcccgcccggaccagggactgaacgcgatccatgcc
atgaccggcgtcctggcttgcgccaatgcagaagccgcccggctgacacacggcccattc
gaagatgtgttcgagccgccctactcgtctcttcaggtcggcacgttgaagggcggccag
gcggtcaacatcattcccgacacctgcgaggccgagttcgaggcgagagccatttccggc
gtcgatccggccgtgctgctggcgccgctgcgggccgcggccgaggccctgccgccactg
ggcttcaaggtggaatggcgcgaactcagcgcctatccggccctgtcgcttgccgccgat
gccccgcttgcccgcctgctgggcgaactgaccggcatcgagccgctcgccgccgtcagc
tacggcaccgaggctggccttttccagcgcgccggcatcgatgcgatcatctgcgggccg
ggtgatatcggccgggcccacaggccggacgaattcattcacgtcagcgagctcctcgcc
tgccaggcaatggtcgaagccctcgcccgccgctgcaccgcctga

DBGET integrated database retrieval system