KEGG   Rhizobium phaseoli: AMC79_PD00653Help
Entry
AMC79_PD00653     CDS       T04590                                 

Gene name
dadX
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rpha  Rhizobium phaseoli
Pathway
rpha00473  D-Alanine metabolism
rpha01100  Metabolic pathways
rpha01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rpha00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AMC79_PD00653 (dadX)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AMC79_PD00653 (dadX)
Enzymes [BR:rpha01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AMC79_PD00653 (dadX)
Peptidoglycan biosynthesis and degradation proteins [BR:rpha01011]
 Precursor biosynthesis
  Racemase
   AMC79_PD00653 (dadX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ANM01821
LinkDB All DBs
Position
pRphaN261d:complement(701463..702596)
Genome map
AA seq 377 aa AA seqDB search
MDSDILGSRERTVTITQGATGYLTIDLAALGRNYLKLASMLAPVRAGAVVKADAYGLGAE
RVAQTLYDQGCRHFFVAQFVEAVRLRPALAEDAQIFVLNGLQPGNEVACAEGGIIPVLNS
LAQWRQWSATARLLTRSLPAVLQFDTGMSRLGFPWEERAELAAVIGDGANVEILFIMSHL
ACADELDSGQNGDQLAEMARIADEFPGFDISFANSGGVFLGDAYHGVLARPGIALYGGAP
NAGGTNPMEPVVRLDVAVVQTRTVPSGARIGYGGAHVTRRETRLATIAAGYADGLPRSPG
DCGAVYHKGTRLPIVGRVSMDSATVDITALPEGALRLGSLVEVLGPNQTLEDVAGAAGTI
SYEILTGLGDRYDRQYC
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggatagcgacattttgggttcccgcgaacgcaccgttacgatcacgcagggagccacc
ggctatctgacgatcgatcttgccgcactcggccgcaattatttgaagctcgcgtcgatg
ctggcgccggtccgcgcgggagccgtcgtcaaggccgacgcttatggtctcggcgccgaa
cgggtcgcccaaacgctctatgatcagggctgcaggcatttcttcgtcgcccagttcgtc
gaggccgtgaggctgcggccagcccttgccgaggatgcccagatattcgtgctgaacggc
ttgcagccaggcaacgaggtcgcctgcgccgaaggcggtatcattccggttctcaattcg
ctcgcgcagtggcggcaatggtcggcgaccgcgcgcttgctgacgcgcagcctgccggcc
gttctgcagtttgacaccggcatgtcgcggctcggctttccctgggaagagcgagccgaa
ttggcggcagtcatcggcgacggcgccaatgtcgagatcctgttcatcatgagccacctg
gcctgtgccgacgagctggatagcggccagaacggcgaccagcttgccgagatggcgcgc
attgccgatgaatttccgggcttcgacatctccttcgccaattccggcggcgtctttctc
ggcgatgcctatcatggcgtgctcgcccgcccgggcatcgccctttatggcggcgcaccg
aacgccggcggcacgaacccgatggaaccggtcgtcaggctggacgtcgccgtcgtgcag
acgcgcaccgtaccttcgggcgccaggatcggttatggcggcgcgcatgtgacgcgcaga
gaaacccgccttgccaccatcgccgccggctatgccgacggcctgccgcgcagtcccggc
gattgcggcgccgtttatcacaagggtacccgtctgccgatcgtcgggcgcgtgtcgatg
gacagcgcgactgtcgatatcacggctttgcccgagggggcactgaggcttggaagcctt
gtcgaagtgcttggcccgaaccagacgctggaagacgtggctggcgctgccggaacgata
tcttacgaaatcctaactggtctgggcgatcgttacgacaggcaatattgctga

DBGET integrated database retrieval system