KEGG   Ralstonia pickettii 12J: Rpic_0240Help
Entry
Rpic_0240         CDS       T00762                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01801  maleylpyruvate isomerase [EC:5.2.1.4]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00350  Tyrosine metabolism
rpi01100  Metabolic pathways
rpi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Rpic_0240
Enzymes [BR:rpi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.4  maleylpyruvate isomerase
     Rpic_0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_5
Motif
Other DBs
NCBI-ProteinID: ACD25402
UniProt: B2UEQ6
LinkDB All DBs
Position
1:255236..255886
Genome map
AA seq 216 aa AA seqDB search
MSIKLYNYFRSSASFRVRIALEVKGLPYDYAPVHLLKGEQLAPDFVKLNPDALVPVLCDG
NDVLNQSLAIVEYLEETHPEPTLLPGSASNRAHIRAIALAIACEIHPLNNPRVLKYLKHT
FNVEEEARNEWYRHWVKLGFAALETRLSQSPLTGAYCVGDTPTLADVCLVPQVFNGKRFD
VAVEDYPTLARIFAHCMAQEAFQRAAPAAQPDAVSA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcaagctgtacaactatttccgcagttcggcgtcattccgcgtgcgtattgcc
ctggaggtcaagggcctgccgtacgactacgcgccggtccacctgctcaagggcgagcaa
ctggcccccgacttcgtcaagctgaaccccgatgcgctggtgcccgtgctgtgcgatggc
aacgacgtgctgaaccagtctttggccatcgtcgagtatctggaagagacgcatcccgag
cccacgctgctgccgggttcggcgagtaatcgcgcgcatatccgcgcgatcgcgctggcc
attgcatgcgagatccatccgctcaacaacccacgcgtgctgaagtatctgaagcacacg
ttcaacgtggaagaagaagcgcgcaacgagtggtatcgccactgggtgaagctggggttt
gcggcgctggaaacgcggctgtcacagtcgccgctgaccggtgcctactgtgttggcgac
acgccaacgctggccgacgtgtgcctcgtgccgcaggtgttcaacggcaagcggttcgat
gtggcggtggaagattacccgacgcttgcgcgcatctttgcgcactgtatggcgcaggag
gcgtttcagcgggctgcgcctgcggcgcagccggatgcggtttccgcgtaa

DBGET integrated database retrieval system