KEGG   Ralstonia pickettii 12J: Rpic_2572Help
Entry
Rpic_2572         CDS       T00762                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00620  Pyruvate metabolism
rpi00680  Methane metabolism
rpi01100  Metabolic pathways
rpi01120  Microbial metabolism in diverse environments
rpi01200  Carbon metabolism
Module
rpi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpic_2572
  09102 Energy metabolism
   00680 Methane metabolism
    Rpic_2572
Enzymes [BR:rpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Rpic_2572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 AAA_22
Motif
Other DBs
NCBI-ProteinID: ACD27700
UniProt: B2UA06
LinkDB All DBs
Position
1:2679971..2682976
Genome map
AA seq 1001 aa AA seqDB search
MTQPAARRASSRATTARKASAAPAKTSKATKAIKAAKPAAKPVAKANGADEANGASLGPT
SRRSSGSAAAKDQPLKEDIRFLGRLLGDVLREQEGGAAFETVETIRQTAVRFRRDGDRQA
EQELDRLLKALSREQTNSVVRAFSYFSHLANIAEDQHHNRRRRVHALAGSPPQPGSMMRA
LLSVADEGVSGETLRRFFDAALIVPVLTAHPTEVQRKSILDAQREIARLLAERDTPLTTR
ERERNTTLLRAHVTKLWQTRMLRTTRLMVADEIENALSYYQTTFLREIPALYRELEEDVA
AVFPRRGARGEPTPLAPFFQMGSWIGGDRDGNPFVTAETLRYAARKQASVILAWYLEEIH
ALGAELSMSTSQVDVSAELLALAEQSPDRSEHRSDEPYRRALIGVYARLAATCRELTGED
AGRHAVGPAPAYTSAEELRADIQIVTDSLAAHHGEALADARLASLARAIDVFGFHLSSID
LRQVSDVHEATVAELLKVAGVEGAYAALSEADKRTLLLRELQQPRLLTLPFHAYSEQTTQ
EIDIFRAAREVRARYGNRIVRNYIISHTETLSDLLEVMLLQKEAGMFRANANGAGVGLDV
MVIPLFETIEDLRNASQIMGDLLALPGFDAVLAAQGNEQEVMLGYSDSNKDGGFLTSNWE
LYKAELALVELFERKGVRLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEI
ISSKFANPEIGRRNLETIVAATLEATLLPTRNRPKGLEEFEAAMQALSDNAFAAYRNLVY
ETPGFKDYFFATTPITEIADLNLGSRPASRKLMDKKHRRIEDLRAIPWGFSWGQCRLLLP
GWFGFGSAVQRWLDDAGNAKARAARLTTLKRMHKQWPFFANLLSNMDMVLSKADLNVASR
YAQLCDDRKLRNAVFSRISAEFALTEQMLAAITGQSERLADNPLLARSIKNRFPYLDPLN
HLQVELLKRFRSGKAGSDDARVRRGIHLSINGIAAGLRNSG
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcccgccgcgcgccgcgcttcctcgcgcgcgaccaccgcccgcaaggcttcc
gccgcccccgccaagaccagcaaggccacgaaggccatcaaggctgccaagcccgccgcc
aaaccggtggccaaggccaatggcgcggacgaagccaatggcgcatcactcggccccact
tcccggcgctcgtcgggcagcgccgcggccaaggatcagccgctgaaggaagacatccgc
tttctgggccgcctgctgggcgacgtgctgcgtgaacaggaaggtggcgccgccttcgaa
accgtcgagacgatccgccagaccgccgtgcgtttccgccgcgacggcgaccgccaggcc
gagcaggaactcgaccgcctgctgaaagccttgtcgcgtgagcaaaccaactccgtggtg
cgcgcgttcagctacttctctcacctggccaacattgccgaagaccagcaccacaaccgc
cgccgccgcgtgcatgcgctggcgggctcgccaccgcagccgggcagcatgatgcgcgcg
ctgctgtcggtggccgacgagggtgtctcgggtgagacgctgcgccgcttcttcgatgcc
gcgttgatcgtgcccgtgctcacggcccacccgaccgaggtgcagcgcaagagcattctc
gatgcacagcgtgaaatcgcccgcctgctggccgaacgcgacacgccgctgaccacccgc
gagcgtgaacgcaacacgacgctgctgcgcgcgcacgtgaccaaactgtggcagacacgc
atgctgcgcaccacgcgtctgatggtggccgacgagatcgaaaacgcgctgtcgtactac
cagacgacgttcctgcgcgagattcccgcgctgtaccgcgaactggaagaggacgtcgct
gccgtattcccgcgccgtggcgcacgtggcgaacccaccccgttggcgccgttcttccag
atgggctcgtggatcggcggcgaccgcgacggcaaccccttcgtcacggcagaaaccctg
cgctacgccgcccgcaagcaggccagtgtgatccttgcgtggtatctggaagagatccac
gcgctgggcgccgaactgtcgatgtcgacatcgcaggtggatgtgagtgctgaattgctg
gcgctggcggagcagtcgcccgatcgatcggagcatcgctcggatgagccgtaccgccgc
gcgctgatcggcgtgtatgcgcgcctggctgcgacgtgccgcgagctgaccggtgaagac
gccggccgccacgccgtcggcccggccccggcttacacgagcgcggaagagctgcgcgcc
gacatccagatcgtcaccgattcgctggcggcacatcacggcgaggcactggctgatgcg
cgtctggcctcgctggcgcgtgcgatcgatgtgttcggcttccacttgtcgtcgatcgac
ttgcggcaggtgtctgacgtgcatgaagcgaccgtcgccgagctgctgaaggtggcgggc
gtggaaggcgcgtacgccgcactgtccgaagccgacaagcgcacgctgctgctgcgcgag
ctgcaacagccgcgtctgctgacgctgccgttccatgcgtacagcgagcagactacgcaa
gagatcgacatcttccgcgccgcgcgcgaggtgcgtgcccgctacggcaaccgcatcgtg
cgcaactacatcatctcgcacaccgagacgctgtcggacctgctcgaagtgatgctgctg
cagaaggaagccggcatgttccgcgcgaatgccaatggcgctggcgtggggctggacgtg
atggtgatcccgctgttcgagaccatcgaagacttgcgcaacgcctcgcagatcatgggc
gatctgcttgccctgcccggcttcgatgccgtactggccgcgcagggcaacgagcaggaa
gtcatgctcggctattcggattccaacaaggacggcggcttcctcacctccaactgggag
ctgtacaaggccgagctggcgctggtggagctgttcgagcgcaagggcgtgcgcctgcgc
ctgttccatggccgcggcggcacggtgggccgaggcggcggcccgacctaccaggccatc
ctgtcgcagccgccgggcacggtgaacgggcagatccgcttgaccgagcagggcgaaatc
atctccagcaagttcgccaaccccgagatcggccggcgcaacctggaaaccatcgtcgcg
gccacgctggaagcgacgctgctgcccacgcgcaaccgcccgaaaggcctggaggagttc
gaagccgcgatgcaggcgctgtcggacaacgcctttgccgcgtaccgcaacctcgtctac
gaaaccccgggcttcaaggactacttcttcgccaccacgcccatcaccgagattgccgac
ctgaacctcggctcgcgcccggcctcgcgcaagctgatggacaagaagcaccgccgcatc
gaagacctgcgtgcgattccgtggggcttctcatggggccagtgccgtctgctgctgccg
ggctggttcggttttggcagcgcggtgcagcgctggctggacgacgccggcaacgcaaag
gcccgcgccgcgcgcctgaccacgctcaagcgcatgcacaagcagtggccgttctttgcg
aacctgctgtcgaacatggacatggtcctgtccaaggccgatctgaacgtggcctcgcgc
tacgcgcagctctgcgacgaccgcaagctgcgtaacgcggtgttctcgcgcatctcggcg
gagttcgcgttgaccgagcagatgctggcagccatcacaggacagtcggagcgcctggcc
gacaacccgctgctggcacgctccatcaagaaccgcttcccgtatctcgacccgctgaat
cacttgcaggtcgaactgctcaagcgcttccgctcgggcaaggccggcagcgacgatgca
cgcgtgcggcgcggcatccatctgtcgatcaacgggattgccgcgggccttcgcaatagc
ggctga

DBGET integrated database retrieval system