KEGG   Ralstonia pickettii 12J: Rpic_2803Help
Entry
Rpic_2803         CDS       T00762                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rpi  Ralstonia pickettii 12J
Brite
Enzymes [BR:rpi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Rpic_2803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACD27927
UniProt: B2UB78
LinkDB All DBs
Position
1:complement(2912368..2913069)
Genome map
AA seq 233 aa AA seqDB search
MIAIPHAFSGYSVYLARGLRRFCKSPTIVAPNLYNPQKARTMEHTLPPLPYAQDALAPHI
SKETLEFHYGKHHQTYVTNLNNLIKGTEFENLSLEDIVKKSSGGVFNNAAQVWNHTFYWN
GLKPQGGGAPTGALADAINAKWGSFDKFKEEFTKTAIGTFGSGWAWLVKKADGSLDLVST
SNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVEAFWNLVNWDFVAKNFA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgattccgcacgcgtttagcggttattccgtctatttagcccgcggtttgcgc
cggttttgcaagtctcctacaatcgtcgctcccaacctgtacaacccacagaaggcaaga
acaatggaacacacgctccccccgctgccgtacgcccaagacgctctggcgccgcacatc
tccaaggaaacgctggagttccactacggcaagcaccaccagacctacgtcacgaacctg
aacaacctgatcaagggcaccgagttcgagaacctgagcctcgaagacatcgtcaagaag
tcctcgggcggtgtgttcaacaacgccgcacaggtctggaaccacacgttctactggaac
ggcctgaagccgcaaggcggcggcgctccgaccggcgcgctggctgacgccatcaacgcc
aagtggggcagcttcgacaagttcaaggaagagttcaccaagacggctatcggcacgttc
ggttcgggctgggcctggctggtgaagaaggccgacggctcgctggatctggtgtcgacc
tccaacgccgccacgccgctgacgaccgacgcgaagccgctgctgacctgcgatgtgtgg
gaacacgcgtactacatcgactaccgtaacgcccgtccgaagtacgtcgaggcgttctgg
aacctggtcaactgggacttcgttgccaagaacttcgcctaa

DBGET integrated database retrieval system