KEGG   Ralstonia pickettii 12J: Rpic_3321Help
Entry
Rpic_3321         CDS       T00762                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
rpi  Ralstonia pickettii 12J
Brite
KEGG Orthology (KO) [BR:rpi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rpi03012]
    Rpic_3321
   03029 Mitochondrial biogenesis [BR:rpi03029]
    Rpic_3321
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpi04147]
    Rpic_3321
Translation factors [BR:rpi03012]
 Eukaryotic Type
  Elongation factors
   Rpic_3321
 Prokaryotic Type
   Rpic_3321
Mitochondrial biogenesis [BR:rpi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Rpic_3321
Exosome [BR:rpi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Rpic_3321
  Exosomal proteins of breast cancer cells
   Rpic_3321
  Exosomal proteins of colorectal cancer cells
   Rpic_3321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACD28443
UniProt: B2UF74
LinkDB All DBs
Position
1:complement(3469162..3470352)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLATKFGGAAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIVVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGEVAIMNLADALDTYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRIERGVVK
VGEELEIVGIKATQKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLCKPGS
IKPHTHFTGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPADKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaaagttcgagcggactaagccgcacgtgaacgttggtacgattggtcac
gttgaccacggcaagacgacgctgacggcagcgatcacgaccgtgctggcgaccaagttt
ggtggtgccgccaaggcatacgaccagattgatgcggcgccggaagaaaaggcacgcggc
atcacgatcaacaccgcacacgttgagtacgaaacggctaaccgtcactacgcgcacgtt
gactgcccgggccacgccgactacgtcaagaacatgattaccggtgccgcccagatggac
ggcgcaatcctggtgtgctcggccgctgacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcccgccaggttggtgtgccgtacatcgtcgtgttcctgaacaagtgcgacatg
gtggacgacgctgagctgctggagctggtcgagatggaggtgcgcgaacttctgtcgaag
tacgacttcccgggcgacgacaccccgatcatcaagggttcggccaagctggcgctggaa
ggcgacaagggcgagctgggcgaagtggccatcatgaacctggccgacgcactggacacc
tacatcccgacgccggagcgcgctgttgacggcacgttcctgatgccggtggaagacgtg
ttctcgatctcgggtcgcggcaccgtggtgaccggccgtatcgagcgcggcgtagtcaag
gtcggcgaagagctggaaatcgtcggtatcaaggccacgcagaagaccacctgcacgggc
gtggaaatgttccgcaagctgctggaccaaggtcaggcaggcgacaacgtcggtatcctg
ctgcgcggcacgaagcgcgaagacgtcgagcgcggccaagtgctatgcaagccgggttcg
atcaagccgcacacgcacttcacgggcgaggtctacatcctgtcgaaggacgaaggcggc
cgtcacacgccgttcttcaacaactaccgtccgcagttctatttccgtacgacggacgtg
accggctcgatcgagctgccggccgacaaggaaatggtcatgccgggcgacaacgtgtcg
atcaccgtcaagctgatcgccccgatcgccatggaagaaggtctgcgcttcgctatccgt
gaaggcggtcgtaccgtcggcgccggcgtcgtcgctaagatcatcgagtaa

DBGET integrated database retrieval system