KEGG   Ralstonia pickettii DTP0602: N234_04640Help
Entry
N234_04640        CDS       T03172                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
rpj  Ralstonia pickettii DTP0602
Pathway
rpj00440  Phosphonate and phosphinate metabolism
rpj01100  Metabolic pathways
rpj01120  Microbial metabolism in diverse environments
rpj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rpj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    N234_04640
Enzymes [BR:rpj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     N234_04640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 NTP_transferase ICL PucR IspD
Motif
Other DBs
NCBI-GeneID: 17100833
NCBI-ProteinID: AGW89306
UniProt: U3QJA2
LinkDB All DBs
Position
1:complement(971107..972813)
Genome map
AA seq 568 aa AA seqDB search
MNARDPAWSTASRSAALRQLLVGSELEFMMEAHNGLSARIVREAGFKAIWASGLAISAQF
GVRDNNEASWTQVVDMLEFMADSSGLPILVDGDTGYGNFNNVRRLVRKLEQRGIVGLCIE
DKQFPKTNSFIDGERQPLATIDEFCGKIKAGKDTQTDADFSIVARVEALIAGWGMDEALR
RAEAYRQAGADAILIHSKLSRPDEILEFAREWAGRAPLVIVPTKYYSTPTEVFRQAGISV
VIWANHLIRAAASSMQAVAKEIHDTQTLVHVEDRIAPVSEIFRLQDADEYSAAERLYLSG
SEAPGAAVVLAASRGEGLDALTAERPKVMLPVAGKPLLRWLVDAFKMQGIHDITVVGGYH
ADAIQSTGVKLVRNERHASTGELASLACAADGLHTDTVIAYGDLLFRSYFLRDLFESECR
FSVVVDSSQTQPSNQSVRDFAYCSAPDDRALFGQKVLLRHVSNKAREVAVTGGQAPQGRW
IGLLCVRGAGREALQQTLAGLRARADFDTLDMPDLLNALIDAGEEIDVKYVHGHWRSVND
LEDYQRAGEFAHARMPFAEGAPGSEKRR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgatccggcttggtccacggcgtcgcgcagcgccgcgctgcgccagttg
ctggtgggcagcgaacttgaattcatgatggaggcccacaacggactctcggcccggatt
gtgcgcgaagcgggcttcaaggccatctgggcctccggcctggcgatctcggcgcaattc
ggcgtgcgcgacaacaacgaggcaagctggacacaagtggtcgacatgctcgaattcatg
gccgattccagcggcttgccgatcctggtcgacggcgataccggctacggcaacttcaac
aatgtgcggcgcctggtgaggaagctcgaacagcgcggcatcgtgggtttgtgcatcgag
gacaagcagttccccaagaccaacagctttatcgacggcgaacgccagccgctggccacc
atcgacgaattctgcggcaagatcaaggccggcaaggatacgcagacggatgccgatttc
tcgatcgtcgcacgcgtggaagcactgatcgcgggctggggcatggacgaggccttgcgc
cgggccgaagcctatcggcaggccggtgccgacgcgatcctgatccacagcaagctgtcg
cggccggatgagatcctcgagttcgcacgcgagtgggccggccgcgctccgctggtgatc
gtgccgaccaagtactacagcacccccaccgaggtgttccgccaggccggcatcagcgtc
gtgatctgggccaaccacctgatccgtgcggcggcatcgtcgatgcaggcggtggccaag
gagatccacgacacccagacgctggttcatgtcgaggaccgtatcgcgccggtgagcgag
atcttccgcctgcaggatgccgacgagtattccgccgccgaacggctgtacctgtctggc
tccgaggcgcccggcgcggcggttgtgctggcggcgagccggggtgaagggcttgacgcc
ctgaccgccgagcggcccaaggtcatgctgccggtcgcaggcaagccgctgctgcgctgg
ctggtggacgccttcaagatgcagggcatccacgacatcaccgtggtcggtggctatcat
gccgatgcgatccagagcacgggtgtcaagctggtgcgcaacgagcgccacgcaagcacc
ggcgaactggcgtcgcttgcgtgcgcggccgacggcctgcatacagataccgtgatcgcc
tacggtgacctgctctttcgcagctacttcctgcgcgacctgttcgagagcgagtgccgc
ttcagcgtggtggtcgactcgtcgcagacgcaaccgtcgaatcagagcgtacgcgatttc
gcctactgctccgcgcctgacgatcgcgccctgttcggccagaaggtcctgctgcggcat
gtgtcgaacaaggcgcgggaagtggccgtcaccggcgggcaggcgccgcaggggcgctgg
atcggcctgctgtgcgtgcgcggcgccgggcgtgaggccttgcagcagacacttgccggc
ctgcgtgcgcgagcggatttcgacacgctggacatgcctgacctgctcaacgccttgatc
gatgcaggcgaggagatcgacgtgaagtatgtgcacggccactggcgcagcgtgaacgac
ctggaggactaccagcgcgcgggcgaattcgcgcatgcccggatgccgttcgccgagggc
gcacccggcagcgagaaacgccgatga

DBGET integrated database retrieval system