KEGG   Ralstonia pickettii DTP0602: N234_11405Help
Entry
N234_11405        CDS       T03172                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
rpj  Ralstonia pickettii DTP0602
Pathway
rpj00061  Fatty acid biosynthesis
rpj00780  Biotin metabolism
rpj01100  Metabolic pathways
rpj01212  Fatty acid metabolism
Module
rpj_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rpj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    N234_11405 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    N234_11405 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rpj01004]
    N234_11405 (fabZ)
Enzymes [BR:rpj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     N234_11405 (fabZ)
Lipid biosynthesis proteins [BR:rpj01004]
 Fatty acid synthase
  Component type
   N234_11405 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas
Motif
Other DBs
NCBI-GeneID: 17102187
NCBI-ProteinID: AGW90637
UniProt: U3QRC9
LinkDB All DBs
Position
1:complement(2458847..2459296)
Genome map
AA seq 149 aa AA seqDB search
MTAADIDIRQILKLLPHRYPFLMVDRVLEFEPGKRIKTLKNVTINEPYFMGHFPEQPVMP
GVMILEALAQSAGLLTFGAEMERKEGSLYYFVGIDGARFKQVVYPGDQLHMNVTVERYIR
GIWKFKAFATVDAKVACEAELMCTVKQAE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagccgacatcgacattcgccagatccttaagctgctgccgcatcgctatccg
ttcctgatggtggaccgcgtgctggagttcgagccgggcaagcgcatcaagacgctgaag
aacgtcaccatcaacgagccttatttcatgggccatttccccgagcaaccggtgatgccg
ggggtgatgatcctcgaggcgctggcacagtccgctggcctgctgactttcggtgcggag
atggagcgcaaggaaggctcgctgtactacttcgtcggcatcgacggcgcccgcttcaag
caggtggtatacccgggcgaccagttgcacatgaacgtgacggtcgagcgctatatccgc
ggcatctggaaattcaaggcgttcgccacggtggacgccaaggtggcctgcgaggcggag
ctgatgtgcaccgtgaagcaggccgagtga

DBGET integrated database retrieval system