KEGG   Ralstonia pickettii DTP0602: N234_12470Help
Entry
N234_12470        CDS       T03172                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
rpj  Ralstonia pickettii DTP0602
Pathway
rpj00250  Alanine, aspartate and glutamate metabolism
rpj00280  Valine, leucine and isoleucine degradation
rpj00410  beta-Alanine metabolism
rpj00640  Propanoate metabolism
rpj00650  Butanoate metabolism
rpj01100  Metabolic pathways
rpj01120  Microbial metabolism in diverse environments
Module
rpj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rpj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    N234_12470
   00650 Butanoate metabolism
    N234_12470
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N234_12470
   00280 Valine, leucine and isoleucine degradation
    N234_12470
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    N234_12470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rpj01007]
    N234_12470
Enzymes [BR:rpj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     N234_12470
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     N234_12470
Amino acid related enzymes [BR:rpj01007]
 Aminotransferase (transaminase)
  Class III
   N234_12470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 17102401
NCBI-ProteinID: AGW90848
UniProt: U3QL75
LinkDB All DBs
Position
1:2681503..2682795
Genome map
AA seq 430 aa AA seqDB search
MTQSNQAHIAARTQHVPHGVVTAHPIFADKAEGSFLWDVEGRRYIDFVGGIGVQNIGHNH
PKVVEAVRRQLGRVTHAAFQVVGYDVYVELAARLNKLVGGAEHYKTLFATTGAEAVENAV
KIARAYRNVPGIIAFRGGFHGRTLLGSTLTGMSTPYKQNFGPLAGDVYHTPYPDEFRGFS
GADAIRALEDLFATQIAPDRIAAIILEPVQGDGGFLPAGNEFLQALRALTRKHGIVLILD
EIQAGFGRTGKMFGFQHAGIQPDLVTVAKSLAGGMPLSGVVGRAEIMDAPAPGGLGGTYA
GNPLACAAALAVLDLFEEEQLLASALALAETLRAGLDQLAREFPAIGTVRGVGAMLALEF
VKDSDPFQPDATFAQAVIDRCRERGLLVIKCGVHRNNVRLLAPLNTSSETAQEALEILRA
AIAQTSNEAR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtccaaccaggcccatatcgcggcccgcacccaacatgttccgcatggcgtc
gtcaccgcccatccgatctttgccgacaaggccgaaggctcgttcctgtgggatgtggaa
ggacgtcgctatatcgatttcgtcggcggcatcggcgtgcagaatatcggccataaccac
cccaaggtcgtcgaggcggtgcgcaggcaactgggtcgggtgacgcacgcagcgttccag
gtggtcggctatgacgtctatgtcgagctggccgcgcggctgaacaagctggtcggcggc
gccgaacactacaagacgctgttcgcgacaaccggcgcggaagcggtggagaacgcggtc
aagatcgcgcgcgcctaccgcaatgtgccggggatcatcgcgttccgcggcggcttccac
gggcgcacgctgctcggctcgacgctgaccggcatgagcacgccgtacaagcagaacttc
gggccgctggccggcgacgtctatcacacgccctatcccgatgaattccgcggtttctcc
ggcgcggatgcgatccgcgcactggaagacctctttgccacgcagatcgccccggatcgc
atcgcggccatcatcctggaaccggtgcaaggcgacggcggcttcctgccggccggcaac
gagttcctgcaggccctgcgcgcgctgacccgcaagcatggcatcgtgctgatcctggat
gagatccaggccggattcggccggaccggcaagatgttcggcttccagcatgcgggcatc
cagccggacctggtcacggtcgcgaagagcctggccggcggcatgccgctgtccggcgtg
gtcgggcgtgccgagatcatggacgcgccggcacccggcgggctgggcggcacgtatgcg
ggcaatccgctcgcctgcgccgcagcgctggcggtgctcgacctgttcgaggaagaacag
ttgctcgccagtgcgctcgcactggctgaaacgctgcgcgcggggctcgaccagctcgcg
cgcgagtttcccgccatcgggaccgtgcgcggcgttggcgcgatgctggcgctggagttc
gtcaaggacagcgatccgttccagcccgacgcgacattcgctcaagcagtgatcgaccgc
tgccgcgagcgcggcctgctggtgatcaagtgcggcgtgcatcggaacaacgtgcgcctg
ctggcgccgctcaacacctcctcggaaacggcgcaggaagccctggagatcttgcgcgcc
gcgattgcgcaaaccagcaacgaggcccggtaa

DBGET integrated database retrieval system