KEGG   Ralstonia pickettii DTP0602: N234_28330Help
Entry
N234_28330        CDS       T03172                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rpj  Ralstonia pickettii DTP0602
Pathway
rpj00630  Glyoxylate and dicarboxylate metabolism
rpj01100  Metabolic pathways
rpj01120  Microbial metabolism in diverse environments
rpj01200  Carbon metabolism
Module
rpj_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rpj_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:rpj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    N234_28330
Enzymes [BR:rpj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     N234_28330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 17105563
NCBI-ProteinID: AGW93944
UniProt: U3QSP8
LinkDB All DBs
Position
2:complement(1578923..1579354)
Genome map
AA seq 143 aa AA seqDB search
MRITQGTFSFLPDLTDAQITSQLEYCLGKGWAVGIEYTDDPHPRNTYWEMFGLPMFDLRD
AAGILLEINNARSTFPNHYIRVTAFDSTHTVESVVMSFIVNRPADEPGFRLVRQEEPGRT
MRYSIESYAVQARPEGSRYRGID
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattactcaaggcactttctccttcctgcccgacctcaccgacgcgcagatcacc
agccagctcgaatactgcctgggcaagggctgggcggtcggcatcgaatacaccgacgac
ccgcatccgcgcaatacctactgggagatgttcggcctgccgatgttcgacctgcgcgat
gccgccggcatcctgctggagatcaacaacgcccgcagcacctttcccaaccactacatc
cgcgtcacggccttcgattcgacccatacggtggagtcggtggtgatgtccttcatcgtc
aatcgtcccgccgacgaacccggcttccgcctggtgcggcaggaggagcccggccgcacg
atgcgctactcgatcgagagctacgccgtgcaggcgaggccggaaggtagtcgctaccgc
ggcatcgactga

DBGET integrated database retrieval system