KEGG   Ralstonia pickettii DTP0602: N234_28335Help
Entry
N234_28335        CDS       T03172                                 

Gene name
rbcL
Definition
(GenBank) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rpj  Ralstonia pickettii DTP0602
Pathway
rpj00630  Glyoxylate and dicarboxylate metabolism
rpj01100  Metabolic pathways
rpj01120  Microbial metabolism in diverse environments
rpj01200  Carbon metabolism
Module
rpj_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rpj_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:rpj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    N234_28335 (rbcL)
Enzymes [BR:rpj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     N234_28335 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 17105564
NCBI-ProteinID: AGW93945
UniProt: U3QSC3
LinkDB All DBs
Position
2:complement(1579402..1580862)
Genome map
AA seq 486 aa AA seqDB search
MNAPETIQAKPRKRYDAGVMKYKEMGYWDGDYEPKDTDLLALFRITPQDGVDPVEAAAAV
AGESSTATWTVVWTDRLTACDMYRAKAYRVDPVPNNPEQFFCYVAYDLSLFEEGSIANLT
ASIIGNVFSFKPIKAARLEDMRFPVAYVKTFAGPSTGIIVERERLDKFGRPLLGATTKPK
LGLSGRNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLFVMDAVNKASAATGEVKG
SYLNVTAGTMEEMYRRAEFAKSLGSVIIMVDLIVGWTCIQSMSNWCRQNDMILHLHRAGH
GTYTRQKNHGVSFRVIAKWLRLAGVDHMHTGTAVGKLEGDPLTVQGYYNVCRDAYTQTDL
TRGLFFDQDWASLRKVMPVASGGIHAGQMHQLISLFGDDVVLQFGGGTIGHPQGIQAGAT
ANRVALEAMVLARNEGRDILNEGPEILRDAARWCGPLRAALDTWGDITFNYTPTDTSDFV
PTASVA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacctgagacgatccaagccaagccgcgcaagcgctacgacgccggcgttatg
aagtacaaggaaatggggtattgggatggcgattacgagcccaaggacaccgacctgctg
gcgctgttccgcatcacgccgcaggacggcgtggacccggtcgaggccgccgccgcggtc
gccggcgaatcctccaccgccacctggacggtggtgtggaccgaccgcctgaccgcctgc
gacatgtaccgcgccaaggcctaccgggtcgatccggtgcccaacaaccccgagcagttc
ttctgctacgtggcctatgacctgtctttgttcgaggaaggctcgatcgccaacctgacc
gcgtcgatcatcggcaacgtcttcagcttcaagccgatcaaggccgcgcgcctggaagac
atgcgcttcccggtcgcctacgtgaagaccttcgccggcccgtcgaccggcatcatcgtc
gagcgcgaacggctggacaagttcggccgcccgctgctgggcgccaccaccaagcccaag
ctcgggctgtcggggcgcaactatggccgcgtggtgtatgagggcctgaagggtggcctg
gacttcatgaaggacgacgagaacatcaactcgcagcctttcatgcactggcgcgaccgc
ttcctgttcgtgatggatgcggtcaacaaggcctcggccgccaccggcgaggtcaagggc
agctacctcaacgtgaccgccggcaccatggaggagatgtaccggcgcgccgagttcgcc
aagtcgctgggctcggtcatcatcatggtcgacctgatcgtcggctggacctgcatccag
tccatgagcaactggtgccgccagaacgacatgatcctgcacctgcaccgcgcgggccat
ggcacctacacccggcagaagaaccacggcgtgtccttccgcgtgatcgcaaaatggctg
cggctggcaggcgtggaccacatgcataccggcaccgcggtgggcaagcttgaaggcgac
ccgcttaccgtgcagggctactacaacgtctgccgcgatgcctacacgcagaccgacctg
acgcgcgggctgttcttcgaccaggactgggcttcgctgcgcaaggtgatgccggtggcc
tccggcggcatccacgccggccagatgcaccagctgatcagcctctttggcgacgacgtg
gtgctgcagttcggcggcggcaccatcggccacccgcagggcatccaggccggcgccacc
gccaaccgcgtcgcgctggaagcgatggtgctggcgcgcaacgaagggcgcgacatcctc
aacgaagggccggaaatcctgcgcgacgccgcgcgctggtgcggaccgctgcgggcggcg
ctcgatacctggggcgacatcaccttcaactacacgccgaccgacacctcggacttcgtg
ccgaccgcgtcggtggcctga

DBGET integrated database retrieval system