KEGG   Ralstonia pickettii DTP0602: N234_30590Help
Entry
N234_30590        CDS       T03172                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rpj  Ralstonia pickettii DTP0602
Pathway
rpj00250  Alanine, aspartate and glutamate metabolism
rpj00410  beta-Alanine metabolism
rpj00640  Propanoate metabolism
rpj00650  Butanoate metabolism
rpj01100  Metabolic pathways
rpj01120  Microbial metabolism in diverse environments
Module
rpj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rpj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    N234_30590
   00650 Butanoate metabolism
    N234_30590
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N234_30590
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    N234_30590
Enzymes [BR:rpj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     N234_30590
Amino acid related enzymes [BR:rpj01007]
 Aminotransferase (transaminase)
  Class III
   N234_30590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 17106018
NCBI-ProteinID: AGW94393
UniProt: U3QVZ2
LinkDB All DBs
Position
2:complement(2090617..2091888)
Genome map
AA seq 423 aa AA seqDB search
MTMKNLELNQRRTLATPRGVGVMCDFYADRAENATLWDVEGRAYTDFAAGIAVLNTGHRH
PRVMQAITAQLERFTHTAYQIVPYQSYVALAERINAMVPIQGLNKTALFTTGAEAVENAI
KIARAHTGRPGVIAFSGAFHGRTLLGMALTGKVAPYKVGFGPFPSDIYHAPFPSALHGVS
TERALQALDSLFKTDIDPGRVAAIIVEPVQGEGGFQAAPSDFMQGLRAVCDQHGIVLIAD
EVQTGFGRTGKMFAMSHYDVEPDLITMAKSLAGGMPLSAVCGRAQIMDAPLPGGLGGTYA
GNPLAVAAAHAVIDVIEEEGLCERSAELGNQLRDHLLAQRKHCPAVAEVRGLGSMIAAEF
CDPATGQPSAEHAKRVQARALEAGLVLLTCGTYGNVIRFLYPLTIPQAQFDAALAVLAQA
LAE
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaaaaacctcgaactgaaccaacgccgaaccctcgcgacgccgcgcggcgtg
ggcgtgatgtgcgatttctatgccgaccgcgcggagaacgccacgctgtgggacgtagaa
ggccgtgcctacaccgacttcgccgccggcatcgccgtgctcaatacgggccaccgccat
ccgcgcgtgatgcaggccatcaccgcgcagctggagcgtttcacgcataccgcctaccag
atcgtgccctaccagagctatgtcgcgctggccgagcgcatcaacgcgatggtgccgatc
cagggcctgaacaagacggccctgttcaccaccggcgccgaagccgtggaaaatgccatc
aagatcgcccgtgcgcataccggccgcccgggcgtgatcgccttctcgggcgccttccat
ggccgcacgttgctgggcatggcgctgactggcaaggtggcgccgtacaaggtcgggttc
ggcccgttcccgtccgacatctaccacgcgccgtttcccagcgcgctgcacggcgtcagc
accgagcgggcgctgcaggcgctggacagcctgttcaagaccgatatcgacccggggcgc
gtggccgcgatcatcgttgagccggtgcaaggcgaaggcggcttccaggcggcgccgtcc
gatttcatgcagggcttgcgggcggtatgtgaccagcacggcatcgtgctgatcgccgat
gaagtgcagactggttttggccgcaccggcaagatgttcgcgatgtcgcactatgacgtc
gagccggacctgatcacgatggccaagagcctggccggcggcatgccgctgtcggcggtc
tgcggccgcgcgcagatcatggatgcgccgctgccaggcggcctcggtggcacctatgcc
ggcaatccgctggcggtggcggcggcgcacgcggtcatcgatgtgattgaggaagaaggg
ctgtgcgagcgctccgccgagcttggcaaccagttgcgcgatcacttgctcgcacagcgc
aagcactgccccgcagtggccgaggtgcgcgggctgggttcgatgatcgctgccgaattc
tgcgatccggccacgggccagcccagcgccgagcatgccaaacgcgtacaggcccgtgcg
ctggaagccggcctggtgctgctgacctgcggcacctacggcaatgtcatccgtttcctc
tatccgctcaccatcccgcaggcgcagttcgacgcagcgctggcggtgctggcccaggcg
ctggccgaataa

DBGET integrated database retrieval system