KEGG   Ralstonia pickettii DTP0602: N234_31370Help
Entry
N234_31370        CDS       T03172                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rpj  Ralstonia pickettii DTP0602
Pathway
rpj00020  Citrate cycle (TCA cycle)
rpj00480  Glutathione metabolism
rpj01100  Metabolic pathways
rpj01110  Biosynthesis of secondary metabolites
rpj01120  Microbial metabolism in diverse environments
rpj01130  Biosynthesis of antibiotics
rpj01200  Carbon metabolism
rpj01210  2-Oxocarboxylic acid metabolism
rpj01230  Biosynthesis of amino acids
Module
rpj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpj_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rpj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    N234_31370
  Metabolism of other amino acids
   00480 Glutathione metabolism
    N234_31370
Enzymes [BR:rpj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     N234_31370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH TROVE
Motif
Other DBs
NCBI-GeneID: 17106173
NCBI-ProteinID: AGW94548
UniProt: U3QWC9
LinkDB All DBs
Position
2:complement(2255644..2257881)
Genome map
AA seq 745 aa AA seqDB search
MSIQQPTIIYTLTDEAPLLATSAFLPIIQTFTKPAGINVTTSDISVAGRILGEFSEFLTE
EQRVPDNLAELGKLTQSPDTNIIKLPNISASVHQLVSAIRELQGKGYKVPDYPEDPKTDE
EKAIQKRYSKCLGSAVNPVLREGNSDRRAPAAVKNYARKHPHSMGEWSMASRTHVAHMKH
GDFYHGEKSMTLDKARDVKMELVTRSGKTIVLKPKVSLQDGEIIDSMFMSKKALCAFYEE
QFEDARQTGVMLSLHVKATMMKVSHPIVFGHAVKIFYKEAFAKHGALFDELGVNVNNGLV
NLYEKIESLPSSKREEIIRDLHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
IGGKMWGADGRPKDTKAVIPESTFARIYQEIINFCKTNGNFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFEITEDGVANIVDLATGEVLLTQNVEQGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAVFWLDPYRPHEAELIKKVEAYLKDYDTNGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEDVGIKTGNAKAKILAKTLDAATGKLLDNNKSPSPKTGQLDNR
GSQFYLAMYWAQELAAQSDDAELAAKFAPLAKTLTDNEQKIVGELAAVQGQPVDIGGYYQ
PDAAKLSAAMRPSQTLNAALQTVAA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagtatccagcaacccaccatcatctacacgctgaccgacgaagctccgctgctggcg
accagtgcgttcctcccgatcatccagacgtttaccaagcccgccggcatcaacgtcacc
accagcgacatctcggtggctggccgtatcctgggcgagttttccgaattcctgaccgaa
gaacagcgcgtgccggacaacctggccgagctgggcaagctgacgcagtcgccggacacc
aacatcatcaagctgccgaacatcagcgcctcggtgcaccagctggtcagcgccatccgc
gaactgcaaggcaagggctacaaggtgccggactatccggaagacccgaagaccgacgaa
gagaaggccatccagaagcgctattccaagtgcctgggcagcgccgtgaacccggtcctg
cgcgaaggcaactccgaccgccgcgcccccgccgcggtcaagaactacgcgcgcaagcac
ccgcacagcatgggcgagtggagcatggcctcgcgcacgcacgtggcccacatgaagcac
ggcgacttctaccacggcgaaaagtccatgaccctggacaaggcccgcgacgtcaagatg
gagctggtcaccaggagcggcaagaccatcgtgctcaagcccaaggtttcgctgcaggac
ggcgagatcatcgacagcatgttcatgagcaagaaggccctgtgcgccttctatgaggag
cagttcgaagacgcgcgccagaccggcgtgatgctgtcgctgcacgtcaaggcgaccatg
atgaaggtgtcgcacccgatcgtgttcggtcacgccgtcaagatcttctacaaggaagcc
ttcgccaagcacggcgcgctgttcgacgaactgggcgtgaacgtcaacaacggcctggtc
aacctgtacgagaagattgagtcgctgcccagctccaagcgcgaagagatcatccgcgac
ctgcacgcctgccacgagcatcgcccggaactggcgatggtggattcggccaagggcatt
tcgaacctgcacgcgcccaacgacgtgatcgtcgatgcctcgatgccggccatgatccgc
atcggcggcaagatgtggggcgccgacggccgtccgaaggacaccaaggccgtgatcccg
gaaagcaccttcgcccgcatctatcaagagatcatcaacttctgcaagaccaacggcaac
ttcgacccgaccaccatgggcacggtgccgaacgtcggcctgatggcgcagaaggccgaa
gagtacggttcgcacgacaagaccttcgagatcaccgaagacggcgtcgccaacatcgtc
gacctggccaccggtgaagtgctgctgacgcagaatgtcgaacagggcgacatctggcgc
atgtgccaggtcaaggacgcgccgatccgcgactgggtcaagctggccgtcacgcgcgcg
cgcaactcgggcatgccggccgtgttctggctggacccgtaccgtccgcacgaggccgag
ctgatcaagaaggtcgaggcctacctgaaggactacgacaccaacggcctggatatccag
atcatgtcgcaggtgcgcgccatgcgctacacgctggagcgcgtgatccgcggcctggac
accatctcggtgaccggcaacatcctgcgcgactacctgaccgacctgttcccgatcatg
gaactgggcaccagcgccaagatgctgtcgatcgtgccgctgatggctggtggcggcatg
tatgaaaccggcgccggcggttcggctccgaaacacgtcaagcagctggtggaagaaaac
cacctgcgctgggattcgctgggtgagtttctggcgctggcggtgtcgctggaagacgtt
ggcatcaagaccggcaatgccaaggccaagatcctggccaagacgctggatgctgccacc
ggcaagctgctggacaacaacaagagcccgtcgcccaagaccggccagctggacaaccgc
ggcagccagttctacctggcgatgtactgggcacaggaactggccgcccagtcggatgac
gcggaactggctgccaagtttgcgccgctggccaagacgctgaccgacaacgagcagaag
atcgtcggtgagctggccgccgtgcagggccagccggtggacatcggtggctactaccag
ccggacgccgccaagctcagcgccgcaatgcgtccgagccagacgctgaacgccgcactg
cagaccgtggcagcctga

DBGET integrated database retrieval system