KEGG   Rickettsia peacockii: RPR_02150Help
Entry
RPR_02150         CDS       T00907                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rpk  Rickettsia peacockii
Pathway
rpk00473  D-Alanine metabolism
rpk00550  Peptidoglycan biosynthesis
rpk01100  Metabolic pathways
rpk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rpk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RPR_02150 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RPR_02150 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    RPR_02150 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rpk01011]
    RPR_02150 (ddl)
Enzymes [BR:rpk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RPR_02150 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:rpk01011]
 Precursor biosynthesis
  Amino acid ligase
   RPR_02150 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 RimK CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACR47277
UniProt: C4K126
LinkDB All DBs
Position
356206..357177
Genome map
AA seq 323 aa AA seqDB search
MHKYQTHWVEHSIVKILSSTGKKHIALMAGGMSAEREVSLVSSEGVSKALIELGYRVTFI
DMGADIAVRLQEIKPDIVFNCLHGTYGEDGCLPGLLNIMRIPYTHSGVLSSALAFNKIHS
RIWFLTNNINMAESIVVNKSDNIKNDPMKRPYVIKPLAQGSSIGVEVIFAEDDFNFADYD
FPYGDQVIIEQYIKGQGRELQVAVLNGKALGALEIKLLKNRFYDYETKYTEGFADHLCPA
PLPANLYEKLLIESEKIYKTMNCKGPARAEFILEEQTNKLYALEINTHPGMMPLSIVPEI
AAYAGINFTNLIEEIIKTASFES
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgcataaatatcaaacacattgggtagaacactctatagtcaaaatattaagtagtacc
ggtaaaaagcatatagcattaatggcaggcggtatgtctgctgagcgtgaagtatcgtta
gtgtcaagcgaaggagttagtaaagctttaattgaattaggatatagagttacctttatt
gatatgggagcggatattgcagttagattacaagaaataaaacctgatatcgtttttaat
tgcctgcacggtacatatggtgaagacggttgtttaccaggattacttaatataatgcgg
attccttatactcatagcggcgtgttatcttcagctttagcattcaataaaatacattct
aggatctggtttttaacgaataatattaatatggcagaaagcattgttgtaaataaaagc
gataatataaaaaatgatcctatgaaacgaccgtacgttattaagcctcttgcgcaaggt
tcaagtattggtgttgaggtgatatttgcagaagacgattttaactttgccgattatgat
tttccttacggtgatcaggtaataatagaacaatatataaaagggcaagggcgagaattg
caagtagcggtattaaacggcaaagctcttggagctttagagattaaattactaaagaat
cgtttctatgattatgaaactaaatataccgaaggatttgctgatcatctttgtcctgct
ccgctacctgctaatttatatgagaaattacttatagaatcagaaaaaatttataaaaca
atgaattgtaaaggtcctgctagagcagagtttattttagaagagcagacaaacaagtta
tatgctttggagataaatactcacccaggtatgatgcctttatcaatagtgccggaaatt
gcagcttatgcagggataaattttactaacttaattgaagaaattataaagacggcaagc
tttgaatcatga

DBGET integrated database retrieval system