KEGG   Rickettsia prowazekii Breinl: H375_4760Help
Entry
H375_4760         CDS       T02543                                 

Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rpl  Rickettsia prowazekii Breinl
Pathway
rpl00970  Aminoacyl-tRNA biosynthesis
rpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    H375_4760
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rpl03029]
    H375_4760
Enzymes [BR:rpl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     H375_4760
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     H375_4760
Mitochondrial biogenesis [BR:rpl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    H375_4760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 15151231
NCBI-ProteinID: AGJ02701
LinkDB All DBs
Position
587218..588669
Genome map
AA seq 483 aa AA seqDB search
MEYIEGNTGKWEYVIGLEIHAQISSKSKLFSGSSTLFAASPNSQVSYVDAAMPGMLPVLN
KHCVYQAIKTGLVLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQDGMIEIPTSTG
DLKTIRINRLHLEQDAGKSIHDQSPYYSLIDLNRAGIGLMEIVTEPDISSPEEAAEFVKK
LRNLLRYIGSCDGDMEKGSMRCDANISVRRIGEALGTRCEIKNINSIRNIIKAIEFEAKR
QVDLLESGETIIQETRLFNVDSCETKTMRLKEEALDYRYFPDPDLLPLIIPDELINELKA
SLPELPDQKIEKYIKKFGLSQYDAGIIVSDEAVAEYFEKAANECNPKMLTNWLITELFGQ
LNKASIGIRECKITPSDFAKLIKLIEHDTISGKIAKTVFEIMFETGKAPDKIVEEKRLVQ
ISDNKILNTVIDEVIAENSKSVKCYKSGKDKLFGFFVGQVMKKTECKANPTLVNKLLKDK
LDS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggaatatattgaagggaatacggggaaatgggaatatgtaataggacttgaaatccat
gctcaaatttcctcaaaatctaagcttttttcaggaagtagcactctttttgcagcaagt
ccaaattcacaagtttcctatgttgatgcagcaatgccagggatgttacctgtattaaat
aaacactgtgtataccaagcaattaaaacaggacttgtacttaaagcgaaaataaataaa
tattcggtatttgatcgtaaaaattatttttatgcagatctaccacaaggataccaaatt
tcacaattttactatcctatagtacaagatggcatgatagaaataccaacgagtactggt
gatcttaagactattcgtattaaccgtttgcatttagagcaagatgctggtaaatctatt
catgatcaatccccatattacagcctaattgatttgaaccgtgctggtatagggcttatg
gagattgtaactgaacctgatatatcatcaccggaagaagcagctgaatttgtaaaaaaa
ctaagaaatttgttacgttatataggcagctgtgacggtgatatggaaaaaggctcgatg
cgttgtgatgctaatatttcagtaaggcggatcggcgaggcactaggtacaagatgcgaa
attaaaaatattaactccatccgtaacatcattaaagcaatagaatttgaagctaaaaga
caagtagatttacttgaaagcggtgaaacaataatccaagaaacacgcttatttaatgta
gatagttgcgaaacaaaaactatgcgtttaaaagaagaagcactcgattacagatatttt
cctgatccagatttattaccacttattattcctgatgagttaataaacgagctaaaagca
agtttgcctgaactacctgatcaaaagattgaaaaatatataaagaaatttggtttaagt
caatatgatgctggaataatagtatcagatgaagctgttgctgagtattttgagaaagca
gcaaatgaatgtaaccctaaaatgctcactaattggctaattactgagttatttggacaa
ttaaacaaagcatcaataggaatacgtgaatgcaaaattactcctagtgactttgcaaag
ttaataaaattaatagaacatgatactatttctgggaaaattgcaaaaaccgtttttgaa
attatgtttgaaactggtaaagcaccagataaaatagtagaagaaaaaagacttgtacaa
atttcagataataaaatactaaacactgtaattgacgaggtaatagctgaaaattctaaa
tcagtaaagtgctataaaagtggtaaagataaattatttggtttttttgtagggcaggta
atgaaaaaaacggaatgtaaagctaatccaacacttgtcaacaaacttttaaaggacaaa
ttagattcttaa

DBGET integrated database retrieval system