KEGG   Rickettsia prowazekii Breinl: H375_5010Help
Entry
H375_5010         CDS       T02543                                 

Definition
(GenBank) Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rpl  Rickettsia prowazekii Breinl
Pathway
rpl00020  Citrate cycle (TCA cycle)
rpl00190  Oxidative phosphorylation
rpl00650  Butanoate metabolism
rpl01100  Metabolic pathways
rpl01110  Biosynthesis of secondary metabolites
rpl01120  Microbial metabolism in diverse environments
rpl01130  Biosynthesis of antibiotics
rpl01200  Carbon metabolism
Module
rpl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rpl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    H375_5010
   00650 Butanoate metabolism
    H375_5010
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    H375_5010
Enzymes [BR:rpl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     H375_5010
    1.3.5.4  fumarate reductase (quinol)
     H375_5010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 DAO FAD_binding_3 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 15151257
NCBI-ProteinID: AGJ02726
LinkDB All DBs
Position
complement(616956..618746)
Genome map
AA seq 596 aa AA seqDB search
MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKIFPTRSHTVAAQGGISAA
LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTVDGKIYQ
RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFIEYFAIDLLMEDGE
CRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMVIRAGLPLQDM
EFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTIE
IREGRGVGEHKDHVFLHLNHLSPEILHRRLPGISETAKIFAGVDVTKDPIPVLPTVHYNM
GGIPTNYQGQVIIKDGKNHNSIVNGIMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSAL
KAAELIKPASPHKPLQKETLEKIINRFDKVRYANGNILVADLRLKMQRTMQSHVSVFRTQ
KLLDEGVGMISEIRNRYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVCSAAARKESR
GAHAREDYPDRNDRDWIKHTLSSIDDSGKVVLDYKPVTLTTLTDAISAIPPVKRVY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagcgtataatataattcatcataaatttgacgtagtagttgtaggtgcaggt
ggagctggactacgttctgcattcggtatggctaaagaagggctaaatactgcttgtatc
actaagatattcccaactcgtagtcataccgtggctgctcagggtggtattagtgctgct
cttggcaatatgggtgaagatgattggcgttggcatatgtatgatactgttaaaggatct
gattggttaggtgatcaggatgctatcgagtatatgtgtaaaaacgctcctgatgctatt
ttagagttagagcattatggtgtgcctttttcaagaacagtagatgggaaaatttatcag
cgtccttttggtggaatgactacggaatacggtaaagggaaagctgctcaacgtacatgt
gctgccgcagatcgtactgggcatgccatactgcatactttatatcagcaatcactaaaa
cataaagtacagttttttattgaatattttgctattgatttattaatggaagatggcgaa
tgtcgaggtgtagttgcgtggaatttagatgatggtagtcttcattgttttagagcgcat
aatgtagtgcttgcaacgggtggatacgggcgtgcttatttttctgctacttctgctcat
acttgtactggtgatggaggtggtatggttattagagctggtcttccattgcaagatatg
gaatttgtacagtttcatccgactggtatatattcggctggttgtcttattactgaagga
gctagaggcgaaggggggtatctagttaatgcaaacggtgagcgttttatggagcgttat
gcacctgctgcgaaggatttagcttcaagagacgtagtctcaagagcaatgactatagaa
atcagagagggacgaggtgttggtgagcataaagatcatgtatttttgcatttaaatcat
ttatcgcctgaaattttacatagacgtttaccaggtatctctgagacggctaaaattttt
gctggtgttgatgtaactaaagatccgataccagtacttcctacggtacattataatatg
ggcgggatacctactaattatcaggggcaagtcataatcaaagacggtaaaaatcataat
agtatagtcaatggaattatggcaatcggtgaagcagcttgcgtatcggtacatggtgct
aaccgattaggctcaaattctttacttgatctagtagtattcggtagaagttctgcatta
aaggctgctgagcttataaaaccagcaagccctcataagcctttacaaaaagaaactctt
gagaaaattataaatagatttgataaggtccgttacgctaacggcaatattttagttgca
gatttaagactgaaaatgcaaagaactatgcaaagccatgtttcagtatttagaacgcaa
aagttactagatgaaggagtaggcatgattagtgaaataagaaatagatataaagatata
aaaattaatgataagtctttaatttggaatagtgatttagtagaagccttagagttagat
aatctacttgatcaggccttagtaacagtatgttcagcagctgcaagaaaagaaagcaga
ggggctcatgcacgtgaagattatcctgaccgtaatgatagagattggattaagcatact
cttagctctattgatgactcaggtaaagtcgttcttgattataaacctgtaacattaacc
actttaaccgatgcaattagtgcaattccaccagtgaagagggtttattaa

DBGET integrated database retrieval system