KEGG   Candidatus Rhodoluna planktonica: A4Z71_02600Help
Entry
A4Z71_02600       CDS       T04564                                 

Definition
(GenBank) hypothetical protein
Organism
rpla  Candidatus Rhodoluna planktonica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collagen DUF2190 DUF2625
Motif
Other DBs
NCBI-ProteinID: AOY55896
UniProt: A0A1D9DYK7
LinkDB All DBs
Position
518962..520161
Genome map
AA seq 399 aa AA seqDB search
MTVLVPGRATLVSTQLLAVGLAALGIGAVAGYSAIPTTLDSGAVLVKGPRGETGPMGPTG
PPGAVGAVGPQGPQGVAGPTGPQGPTGADGAPGQAGPIGEIGPAGNDGAPGQPGPSGAIG
PAGPTGDTGPMGPTGPQGETGPQGLAGPQGIQGIQGIQGEIGPMGPTGIVVATSPLQYNA
DTRTISLDLDAFERLGSLDYLQFNTSSTAERQPGRLVWNDVDGTLDLRLKENLVTLQIGQ
ESVQVVLNNTGGTLLNGRAVRVTGSSGGRMTVTHADNSTVIGSTGVIGVLTEDIEPNTVG
YVTTYGLVRDTNTSSWAAGAPLYADGSGVLTDVRPVNGRVVQIGYVAQSDATNGIIYVNP
MQNFEPPIGGPCQVPGQTGLGTYAWHNLTGQRWIVVCDY
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgacagttttggttcctggcagggccactttagtaagcactcagctattagctgtcggt
ttggcggctcttggaatcggcgctgttgctggctattcggcaattccaaccacccttgac
tccggcgctgttttggtgaaaggtccacgaggtgaaaccgggccgatgggccctaccggc
cctcctggggccgtaggtgccgttggcccgcaaggtcctcagggcgtggcaggacccacg
gggccgcagggtccaactggcgctgatggagcaccgggacaagctggcccgatcggcgaa
attgggcctgcaggaaacgatggtgcacctggacaaccaggaccttcgggtgccatcggc
ccggcagggcctaccggtgacactgggccaatgggtcctactgggccgcagggtgagacc
ggcccacagggcctggctggccctcagggtattcagggaatacagggaatacagggcgaa
attgggccaatgggtccaaccggcatcgtcgtagctacttcgccactgcagtacaacgct
gacacgagaaccatttcactcgaccttgatgcgtttgagcggttaggctctctcgactat
ctgcaattcaatacttcctctacggctgaacgtcagcccggtcggctggtgtggaatgac
gttgatggcactctagatttgaggctgaaagaaaatctagtaactctccaaattggtcaa
gaatctgtgcaggtggtactgaacaataccggtggaactctgctgaacggccgcgctgta
agggtaaccggatcaagtggcggtcgaatgacggttacgcatgctgataattcgactgtg
atcggctcaactggtgtgataggcgttttgaccgaagatatcgaaccaaacaccgtgggc
tatgtgaccacctatggtcttgtacgtgacactaacacttcaagctgggccgcgggcgca
ccgctgtatgcggatggtagtggagttttgaccgatgtgcgaccggtgaatggtcgagta
gttcaaattggctatgttgcccagtcagatgccacgaacggaattatttacgtgaatccc
atgcaaaattttgagccgccaatcggtggcccttgccaggttccaggtcaaacgggcttg
gggacttacgcgtggcacaacctcactggtcaacgctggatagtagtttgtgattactaa

DBGET integrated database retrieval system